Historia de #mexico 11/04/2026 02:43 11 visitas

Hour Alias Mensaje Mensaje
[02:43] Flamenco}Eficiente !jugar [02:43] Flamenco}Eficiente
!jugar
[02:43] Serpiente-Marron EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!! [02:43] Serpiente-Marron
EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!!
[02:43] Serpiente-Marron R᮫ing �ltima SEMANA: #1: Culebra{Naranja 10483560 #2: Gladiadora_del_Caribe 6590569 #3: siva- 4847579 [02:43] Serpiente-Marron
R᮫ing �ltima SEMANA: #1: Culebra{Naranja 10483560 #2: Gladiadora_del_Caribe 6590569 #3: siva- 4847579
[02:43] Serpiente-Marron Tri.528 Informaticaɐax˿EntcuantasmposicionesmpuedegestarccadasunoqdeglosmejesmdeguntjoystickdanalogicoqdegPCn?n [02:43] Serpiente-Marron
Tri.528 Informaticaɐax˿EntcuantasmposicionesmpuedegestarccadasunoqdeglosmejesmdeguntjoystickdanalogicoqdegPCn?n
[02:43] Serpiente-Marron 1 Pista: *** Valor pregunta : 9991 Puntos [02:43] Serpiente-Marron
1 Pista: *** Valor pregunta : 9991 Puntos
[02:43] Serpiente-Marron 2 Pista: 256 30 segundos y 9991 Puntos [02:43] Serpiente-Marron
2 Pista: 256 30 segundos y 9991 Puntos
[02:43] Serpiente-Marron 3 Pista: 256 15 segundos y 9991 Puntos [02:43] Serpiente-Marron
3 Pista: 256 15 segundos y 9991 Puntos
[02:44] Serpiente-Marron Tiempo! La respuesta es -> 256 <- [02:44] Serpiente-Marron
Tiempo! La respuesta es -> 256 <-
[02:44] Serpiente-Marron Top10 Players ( Weekly & Monthly ) are Auto-Voiced [02:44] Serpiente-Marron
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[02:44] Serpiente-Marron Tri.11669 PoliticaɁker˿AFAMADOlPERSONAJElQUElHIZOlFAMOSAlLAlFRASEl"ESPAсlVAlBIENl?l [02:44] Serpiente-Marron
Tri.11669 PoliticaɁker˿AFAMADOlPERSONAJElQUElHIZOlFAMOSAlLAlFRASEl"ESPAсlVAlBIENl?l
[02:44] Serpiente-Marron 1 Pista: **** ***** ***** Valor pregunta : 5042 Puntos [02:44] Serpiente-Marron
1 Pista: **** ***** ***** Valor pregunta : 5042 Puntos
[02:44] Cocodrilo-Naranja ¦ Emitiendo ( elvigilante ) | Lugar ( Puerto Rico ) | Temática ( Musica Variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Pide tu canción comando: .tocame Tema-Artista [02:44] Cocodrilo-Naranja
¦ Emitiendo ( elvigilante ) | Lugar ( Puerto Rico ) | Temática ( Musica Variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Pide tu canción comando: .tocame Tema-Artista
[02:44] Serpiente-Marron 2 Pista: jos* ***** ***** 30 segundos y 5042 Puntos [02:44] Serpiente-Marron
2 Pista: jos* ***** ***** 30 segundos y 5042 Puntos
[02:44] Serpiente-Marron 3 Pista: jose *a*ia a**a* 15 segundos y 5042 Puntos [02:44] Serpiente-Marron
3 Pista: jose *a*ia a**a* 15 segundos y 5042 Puntos
[02:45] Serpiente-Marron Tiempo! La respuesta es -> jose�aria�znar <- [02:45] Serpiente-Marron
Tiempo! La respuesta es -> jose�aria�znar <-
[02:45] Serpiente-Marron Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [02:45] Serpiente-Marron
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[02:45] Serpiente-Marron Tri.17056 Idiomasɓebosin˿Diccionario-Qu郰1nadjetivousebutilizaeparaereferirsebaelouquebescrelativouaelaera�n?n [02:45] Serpiente-Marron
Tri.17056 Idiomasɓebosin˿Diccionario-Qu郰1nadjetivousebutilizaeparaereferirsebaelouquebescrelativouaelaera�n?n
[02:45] Serpiente-Marron 1 Pista: ******* Valor pregunta : 22559 Puntos [02:45] Serpiente-Marron
1 Pista: ******* Valor pregunta : 22559 Puntos
[02:45] Serpiente-Marron 2 Pista: rad**** 30 segundos y 22559 Puntos [02:45] Serpiente-Marron
2 Pista: rad**** 30 segundos y 22559 Puntos
[02:45] Serpiente-Marron 3 Pista: radi*a* 15 segundos y 22559 Puntos [02:45] Serpiente-Marron
3 Pista: radi*a* 15 segundos y 22559 Puntos
[02:45] Serpiente-Marron Tiempo! La respuesta es -> radical <- [02:45] Serpiente-Marron
Tiempo! La respuesta es -> radical <-
[02:46] Serpiente-Marron R᮫ing SEMANA: - #1: Culebra{Naranja 8268726 #2: Gladiadora_del_Caribe 6723585 #3: CAP2630 2205895 #4: Sirena__ 1107842 #5: Alii 1036251 #6: siva- 530841 #7: Cosmo 427307 #8: Ketzy 308075 #9: KaZuMa_KiRyU 230692 #10: kitana_- 213209 [02:46] Serpiente-Marron
R᮫ing SEMANA: - #1: Culebra{Naranja 8268726 #2: Gladiadora_del_Caribe 6723585 #3: CAP2630 2205895 #4: Sirena__ 1107842 #5: Alii 1036251 #6: siva- 530841 #7: Cosmo 427307 #8: Ketzy 308075 #9: KaZuMa_KiRyU 230692 #10: kitana_- 213209
[02:46] Serpiente-Marron Tri.18475 Personajesɖivian˿Cu᮴osqviajesqhizogSimbad?f?f [02:46] Serpiente-Marron
Tri.18475 Personajesɖivian˿Cu᮴osqviajesqhizogSimbad?f?f
[02:46] Serpiente-Marron 1 Pista: ***** Valor pregunta : 24535 Puntos [02:46] Serpiente-Marron
1 Pista: ***** Valor pregunta : 24535 Puntos
[02:46] Serpiente-Marron 2 Pista: sie** 30 segundos y 24535 Puntos [02:46] Serpiente-Marron
2 Pista: sie** 30 segundos y 24535 Puntos
[02:46] Serpiente-Marron 3 Pista: sie*e 15 segundos y 24535 Puntos [02:46] Serpiente-Marron
3 Pista: sie*e 15 segundos y 24535 Puntos
[02:46] Serpiente-Marron Tiempo! La respuesta es -> siete <- [02:46] Serpiente-Marron
Tiempo! La respuesta es -> siete <-
[02:47] Serpiente-Marron We feature over 50,000 Q&A ! [02:47] Serpiente-Marron
We feature over 50,000 Q&A !
[02:47] Serpiente-Marron Tri.639 Biologiaɳtephewo˿Desdeqell1945qqueqporcentajeqdeqselvasjtropicalesjseqhafdestruidoh(...qporfciento)?q?q [02:47] Serpiente-Marron
Tri.639 Biologiaɳtephewo˿Desdeqell1945qqueqporcentajeqdeqselvasjtropicalesjseqhafdestruidoh(...qporfciento)?q?q
[02:47] Serpiente-Marron 1 Pista: ** *** ****** Pregunta de BONUS : 25000 Puntos [02:47] Serpiente-Marron
1 Pista: ** *** ****** Pregunta de BONUS : 25000 Puntos
[02:47] Serpiente-Marron 2 Pista: 40�** ****** 30 segundos y 25000 Puntos [02:47] Serpiente-Marron
2 Pista: 40�** ****** 30 segundos y 25000 Puntos
[02:47] Serpiente-Marron 3 Pista: 40�o* *ie**o 15 segundos y 25000 Puntos [02:47] Serpiente-Marron
3 Pista: 40�o* *ie**o 15 segundos y 25000 Puntos
[02:47] Serpiente-Marron Tiempo! La respuesta es -> 40�or�iento <- [02:47] Serpiente-Marron
Tiempo! La respuesta es -> 40�or�iento <-
[02:47] Serpiente-Marron Tri.8681 Eros-SexɁrzobispo˿Comozsejlawllamawawlawpersonawquejnozpuedejprocrear?w?w [02:47] Serpiente-Marron
Tri.8681 Eros-SexɁrzobispo˿Comozsejlawllamawawlawpersonawquejnozpuedejprocrear?w?w
[02:47] Serpiente-Marron 1 Pista: ******* Pregunta de BONUS : 25000 Puntos [02:47] Serpiente-Marron
1 Pista: ******* Pregunta de BONUS : 25000 Puntos
[02:48] Serpiente-Marron 2 Pista: est**** 30 segundos y 25000 Puntos [02:48] Serpiente-Marron
2 Pista: est**** 30 segundos y 25000 Puntos
[02:48] Serpiente-Marron 3 Pista: este*i* 15 segundos y 25000 Puntos [02:48] Serpiente-Marron
3 Pista: este*i* 15 segundos y 25000 Puntos
[02:48] Serpiente-Marron Tiempo! La respuesta es -> esteril <- [02:48] Serpiente-Marron
Tiempo! La respuesta es -> esteril <-
[02:48] Serpiente-Marron Tri.13667 CienciaɊAVEA˿19aDEaMAYOaDEa1971:aAaQUEaPLANETAaENVIAaLAaURSSaUNAaNAVEaESPACIALa?a [02:48] Serpiente-Marron
Tri.13667 CienciaɊAVEA˿19aDEaMAYOaDEa1971:aAaQUEaPLANETAaENVIAaLAaURSSaUNAaNAVEaESPACIALa?a
[02:48] Serpiente-Marron 1 Pista: ***** Valor pregunta : 13384 Puntos [02:48] Serpiente-Marron
1 Pista: ***** Valor pregunta : 13384 Puntos
[02:49] Serpiente-Marron 2 Pista: mar** 30 segundos y 13384 Puntos [02:49] Serpiente-Marron
2 Pista: mar** 30 segundos y 13384 Puntos
[02:49] Serpiente-Marron 3 Pista: mar*e 15 segundos y 13384 Puntos [02:49] Serpiente-Marron
3 Pista: mar*e 15 segundos y 13384 Puntos
[02:49] Serpiente-Marron Tiempo! La respuesta es -> marte <- [02:49] Serpiente-Marron
Tiempo! La respuesta es -> marte <-
[02:49] Serpiente-Marron Please remember this is a FREE service, Please do not complain [02:49] Serpiente-Marron
Please remember this is a FREE service, Please do not complain
[02:49] Serpiente-Marron Tri.20346 Personajesɤruida˿Enpqu郰1eciudadlpas󃰱eVivaldiwmuchosqa񯳃01qdensubvidaxcomocprofesorqdenviol�e?e [02:49] Serpiente-Marron
Tri.20346 Personajesɤruida˿Enpqu郰1eciudadlpas󃰱eVivaldiwmuchosqa񯳃01qdensubvidaxcomocprofesorqdenviol�e?e
[02:49] Serpiente-Marron 1 Pista: ******* Valor pregunta : 23409 Puntos [02:49] Serpiente-Marron
1 Pista: ******* Valor pregunta : 23409 Puntos
[02:50] Serpiente-Marron 2 Pista: ven**** 30 segundos y 23409 Puntos [02:50] Serpiente-Marron
2 Pista: ven**** 30 segundos y 23409 Puntos
[02:50] Serpiente-Marron 3 Pista: vene*ia 15 segundos y 23409 Puntos [02:50] Serpiente-Marron
3 Pista: vene*ia 15 segundos y 23409 Puntos
[02:50] Serpiente-Marron Tiempo! La respuesta es -> venecia <- [02:50] Serpiente-Marron
Tiempo! La respuesta es -> venecia <-
[02:50] Serpiente-Marron R᮫ing �ltimo MES: #1: Culebra{Naranja 52886387 #2: Gladiadora_del_Caribe 23128897 #3: Flamenco}Eficiente 15623946 #4: siva- 10800261 #5: Guiarte_Yo 2584013 [02:50] Serpiente-Marron
R᮫ing �ltimo MES: #1: Culebra{Naranja 52886387 #2: Gladiadora_del_Caribe 23128897 #3: Flamenco}Eficiente 15623946 #4: siva- 10800261 #5: Guiarte_Yo 2584013
[02:50] Serpiente-Marron Tri.16016 Musicaɂuzzati˿DANZAcCORTESANA,cDEcCAR�TERcGRAVEcYcSOLEMNE,cYcCONcMOVIMIENTOScPAUSADOSc?c [02:50] Serpiente-Marron
Tri.16016 Musicaɂuzzati˿DANZAcCORTESANA,cDEcCAR�TERcGRAVEcYcSOLEMNE,cYcCONcMOVIMIENTOScPAUSADOSc?c
[02:50] Serpiente-Marron 1 Pista: ****** Valor pregunta : 20440 Puntos [02:50] Serpiente-Marron
1 Pista: ****** Valor pregunta : 20440 Puntos
[02:50] Serpiente-Marron 2 Pista: pav*** 30 segundos y 20440 Puntos [02:50] Serpiente-Marron
2 Pista: pav*** 30 segundos y 20440 Puntos
[02:51] Serpiente-Marron 3 Pista: pava*a 15 segundos y 20440 Puntos [02:51] Serpiente-Marron
3 Pista: pava*a 15 segundos y 20440 Puntos
[02:51] Serpiente-Marron Tiempo! La respuesta es -> pavana <- [02:51] Serpiente-Marron
Tiempo! La respuesta es -> pavana <-
[02:51] Serpiente-Marron If you think a Q&A is wrong, please call an OP [02:51] Serpiente-Marron
If you think a Q&A is wrong, please call an OP
[02:51] Serpiente-Marron Tri.333 Musicaɂruce˿Enbqueaa񯃰1unaci󃰱rBruceaSpringsteenb?r [02:51] Serpiente-Marron
Tri.333 Musicaɂruce˿Enbqueaa񯃰1unaci󃰱rBruceaSpringsteenb?r
[02:51] Serpiente-Marron 1 Pista: **** Pregunta de BONUS : 50000 Puntos [02:51] Serpiente-Marron
1 Pista: **** Pregunta de BONUS : 50000 Puntos
[02:51] Serpiente-Marron 2 Pista: 194* 30 segundos y 50000 Puntos [02:51] Serpiente-Marron
2 Pista: 194* 30 segundos y 50000 Puntos
[02:51] Culebra{Naranja !Stats [02:51] Culebra{Naranja
!Stats
[02:51] Tigre-SinRespeto Realización de estadísticas en curso. Solicitadas por: Culebra{Naranja. [02:51] Tigre-SinRespeto
Realización de estadísticas en curso. Solicitadas por: Culebra{Naranja.
[02:52] Serpiente-Marron 3 Pista: 194* 15 segundos y 50000 Puntos [02:52] Serpiente-Marron
3 Pista: 194* 15 segundos y 50000 Puntos
[02:52] Tigre-SinRespeto Resumen de estadísticas - Los que más han escrito hoy -> Serpiente-Marron ( 275 ), wlecome3 ( 13), ENTRE-MUSICA ( 4), Ketzy ( 3), Fr4Y_T0Rm3Nt4 ( 1), pija ( 1 ) [02:52] Tigre-SinRespeto
Resumen de estadísticas - Los que más han escrito hoy -> Serpiente-Marron ( 275 ), wlecome3 ( 13), ENTRE-MUSICA ( 4), Ketzy ( 3), Fr4Y_T0Rm3Nt4 ( 1), pija ( 1 )
[02:52] Tigre-SinRespeto Estadísticas actualizadas por Culebra{Naranja. Visite las estadísticas en https://www.winstats.es/stats/mexico.html [02:52] Tigre-SinRespeto
Estadísticas actualizadas por Culebra{Naranja. Visite las estadísticas en https://www.winstats.es/stats/mexico.html
[02:52] Serpiente-Marron Tiempo! La respuesta es -> 1949 <- [02:52] Serpiente-Marron
Tiempo! La respuesta es -> 1949 <-
[02:52] Serpiente-Marron R᮫ing por D́: - Domingo: Gladiadora_del_Caribe 1799967 Lunes: CAP2630 2205895 Martes: Culebra{Naranja 1914185 Miercoles: Culebra{Naranja 1715545 Jueves: Culebra{Naranja 1769462 Viernes: Gladiadora_del_Caribe 1992978 Sᢡdo: Gladiadora_del_Caribe 1324395 [02:52] Serpiente-Marron
R᮫ing por D́: - Domingo: Gladiadora_del_Caribe 1799967 Lunes: CAP2630 2205895 Martes: Culebra{Naranja 1914185 Miercoles: Culebra{Naranja 1715545 Jueves: Culebra{Naranja 1769462 Viernes: Gladiadora_del_Caribe 1992978 Sᢡdo: Gladiadora_del_Caribe 1324395
[02:52] Serpiente-Marron Tri.15325 Cancionesɰamo_˿Deaquienaesllafcanciona"Prettydflyd(forjafwhiteaguy)"v?v [02:52] Serpiente-Marron
Tri.15325 Cancionesɰamo_˿Deaquienaesllafcanciona"Prettydflyd(forjafwhiteaguy)"v?v
[02:52] Serpiente-Marron 1 Pista: ********* Valor pregunta : 23002 Puntos [02:52] Serpiente-Marron
1 Pista: ********* Valor pregunta : 23002 Puntos
[02:52] Serpiente-Marron 2 Pista: off****** 30 segundos y 23002 Puntos [02:52] Serpiente-Marron
2 Pista: off****** 30 segundos y 23002 Puntos
[02:53] Serpiente-Marron 3 Pista: off***i** 15 segundos y 23002 Puntos [02:53] Serpiente-Marron
3 Pista: off***i** 15 segundos y 23002 Puntos
[02:53] Serpiente-Marron Tiempo! La respuesta es -> offspring <- [02:53] Serpiente-Marron
Tiempo! La respuesta es -> offspring <-
[02:53] Serpiente-Marron For The Competitive Edge type !pingme [02:53] Serpiente-Marron
For The Competitive Edge type !pingme
[02:53] Serpiente-Marron Tri.5599 Cancionesɬatribu˿Cancionfdeo1979acuyostderechostfueronfcedidostporasustautorestaqUNICEFa?a [02:53] Serpiente-Marron
Tri.5599 Cancionesɬatribu˿Cancionfdeo1979acuyostderechostfueronfcedidostporasustautorestaqUNICEFa?a
[02:53] Serpiente-Marron 1 Pista: ********** Pregunta de BONUS : 50000 Puntos [02:53] Serpiente-Marron
1 Pista: ********** Pregunta de BONUS : 50000 Puntos
[02:53] Serpiente-Marron 2 Pista: chi******* 30 segundos y 50000 Puntos [02:53] Serpiente-Marron
2 Pista: chi******* 30 segundos y 50000 Puntos
[02:53] Serpiente-Marron 3 Pista: chi*ui*i*a 15 segundos y 50000 Puntos [02:53] Serpiente-Marron
3 Pista: chi*ui*i*a 15 segundos y 50000 Puntos
[02:54] Serpiente-Marron Tiempo! La respuesta es -> chiquitita <- [02:54] Serpiente-Marron
Tiempo! La respuesta es -> chiquitita <-
[02:54] Serpiente-Marron Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [02:54] Serpiente-Marron
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[02:54] Serpiente-Marron Tri.1402 InformaticaɌucky_LuK˿AqQUEqSEqREFIEREqENqINTERNET2qLASqSIGLASqLFNq?q [02:54] Serpiente-Marron
Tri.1402 InformaticaɌucky_LuK˿AqQUEqSEqREFIEREqENqINTERNET2qLASqSIGLASqLFNq?q
[02:54] Serpiente-Marron 1 Pista: **** *** ******* Valor pregunta : 19151 Puntos [02:54] Serpiente-Marron
1 Pista: **** *** ******* Valor pregunta : 19151 Puntos
[02:54] Serpiente-Marron 2 Pista: LON* *** ******* 30 segundos y 19151 Puntos [02:54] Serpiente-Marron
2 Pista: LON* *** ******* 30 segundos y 19151 Puntos
[02:54] Serpiente-Marron 3 Pista: LON* *A* *E**O** 15 segundos y 19151 Puntos [02:54] Serpiente-Marron
3 Pista: LON* *A* *E**O** 15 segundos y 19151 Puntos
[02:55] Serpiente-Marron Tiempo! La respuesta es -> LONG�AT�ETWORK <- [02:55] Serpiente-Marron
Tiempo! La respuesta es -> LONG�AT�ETWORK <-
[02:55] Serpiente-Marron R᮫ing MES: - #1: Culebra{Naranja 14787290 #2: Gladiadora_del_Caribe 11737007 #3: siva- 2676459 #4: Fred46 2616141 #5: CAP2632 2481083 #6: CAP2630 2205895 #7: Sirena__ 1241518 #8: Alii 1036251 #9: Cosmo 1009399 #10: MorenoAltoyFibrado 886845 [02:55] Serpiente-Marron
R᮫ing MES: - #1: Culebra{Naranja 14787290 #2: Gladiadora_del_Caribe 11737007 #3: siva- 2676459 #4: Fred46 2616141 #5: CAP2632 2481083 #6: CAP2630 2205895 #7: Sirena__ 1241518 #8: Alii 1036251 #9: Cosmo 1009399 #10: MorenoAltoyFibrado 886845
[02:55] Serpiente-Marron Tri.3407 GastronomiaɁker˿ELfQUESOfCABRALESfESfT͐ICOfDEf?f [02:55] Serpiente-Marron
Tri.3407 GastronomiaɁker˿ELfQUESOfCABRALESfESfT͐ICOfDEf?f
[02:55] Serpiente-Marron 1 Pista: ******** Pregunta de BONUS : 25000 Puntos [02:55] Serpiente-Marron
1 Pista: ******** Pregunta de BONUS : 25000 Puntos
[02:55] Serpiente-Marron 2 Pista: ast***** 30 segundos y 25000 Puntos [02:55] Serpiente-Marron
2 Pista: ast***** 30 segundos y 25000 Puntos
[02:55] Culebra{Naranja asturias [02:55] Culebra{Naranja
asturias
[02:55] Serpiente-Marron �e nota que sabes mucho de esto Culebra{Naranja! Tu respuesta "asturias" es correcta y ganas �5000�12 puntos [02:55] Serpiente-Marron
�e nota que sabes mucho de esto Culebra{Naranja! Tu respuesta "asturias" es correcta y ganas �5000�12 puntos
[02:55] Serpiente-Marron Culebra{Naranja has acertado 23 seguidas!! Puntos HOY: 25000, SEMANA: 8293726 y MES: 14812290 [02:55] Serpiente-Marron
Culebra{Naranja has acertado 23 seguidas!! Puntos HOY: 25000, SEMANA: 8293726 y MES: 14812290
[02:55] Serpiente-Marron 23 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [02:55] Serpiente-Marron
23 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[02:55] Serpiente-Marron Please refrain from using Extreme Bad Language [02:55] Serpiente-Marron
Please refrain from using Extreme Bad Language
[02:55] Serpiente-Marron Tri.16743 PoliticaɄonNadie˃argoupol�coudeqJosepmBorrelli(eny2004).q?q [02:55] Serpiente-Marron
Tri.16743 PoliticaɄonNadie˃argoupol�coudeqJosepmBorrelli(eny2004).q?q
[02:55] Serpiente-Marron 1 Pista: ********** *** ********** ******* Pregunta de BONUS : 50000 Puntos [02:55] Serpiente-Marron
1 Pista: ********** *** ********** ******* Pregunta de BONUS : 50000 Puntos
[02:56] Serpiente-Marron 2 Pista: pre******* *** ********** ******* 30 segundos y 50000 Puntos [02:56] Serpiente-Marron
2 Pista: pre******* *** ********** ******* 30 segundos y 50000 Puntos
[02:56] Serpiente-Marron 3 Pista: pre*i*e**e *e* *a**a*e**o eu*o*eo 15 segundos y 50000 Puntos [02:56] Serpiente-Marron
3 Pista: pre*i*e**e *e* *a**a*e**o eu*o*eo 15 segundos y 50000 Puntos
[02:56] Culebra{Naranja presidente del parlamento europeo [02:56] Culebra{Naranja
presidente del parlamento europeo
[02:56] Serpiente-Marron �Absolutamente correcto Culebra{Naranja!! Acertaste "presidente del parlamento europeo" en �0.891 segundos y ganas �0000�12 puntos [02:56] Serpiente-Marron
�Absolutamente correcto Culebra{Naranja!! Acertaste "presidente del parlamento europeo" en �0.891 segundos y ganas �0000�12 puntos
[02:56] Serpiente-Marron Culebra{Naranja has acertado 24 seguidas!! Puntos HOY: 75000, SEMANA: 8343726 y MES: 14862290 [02:56] Serpiente-Marron
Culebra{Naranja has acertado 24 seguidas!! Puntos HOY: 75000, SEMANA: 8343726 y MES: 14862290
[02:56] Serpiente-Marron 24 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [02:56] Serpiente-Marron
24 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[02:56] Serpiente-Marron This is #Mexico, I am your host Serpiente-Marron, running Serpiente-Marron [02:56] Serpiente-Marron
This is #Mexico, I am your host Serpiente-Marron, running Serpiente-Marron
[02:56] Serpiente-Marron Tri.10261 Deporteɚytox˿EnwquelciudadrselproclamozAlexaCorretjajcampeonwdelhMastersn?a [02:56] Serpiente-Marron
Tri.10261 Deporteɚytox˿EnwquelciudadrselproclamozAlexaCorretjajcampeonwdelhMastersn?a
[02:56] Serpiente-Marron 1 Pista: ******** Valor pregunta : 24599 Puntos [02:56] Serpiente-Marron
1 Pista: ******** Valor pregunta : 24599 Puntos
[02:56] Serpiente-Marron 2 Pista: han***** 30 segundos y 24599 Puntos [02:56] Serpiente-Marron
2 Pista: han***** 30 segundos y 24599 Puntos
[02:57] Serpiente-Marron 3 Pista: han*o*e* 15 segundos y 24599 Puntos [02:57] Serpiente-Marron
3 Pista: han*o*e* 15 segundos y 24599 Puntos
[02:57] Culebra{Naranja hannower [02:57] Culebra{Naranja
hannower
[02:57] Serpiente-Marron Tiempo! La respuesta es -> hannover <- [02:57] Serpiente-Marron
Tiempo! La respuesta es -> hannover <-
[02:57] Serpiente-Marron This WEEKS Top 11-20: - #11: Fred46 189310 #12: lindisita1 151021 #13: Yobiss 142697 #14: AlitaSs 98904 #15: Fernanda16 94755 #16: NN_vOx_exterminio-fiscal 68804 #17: LeCaTwaLk_z 66815 #18: m-bladee 50000 #19: Chiqktrks_- 43194 #20: MorenoAltoyFibrado 29890 [02:57] Serpiente-Marron
This WEEKS Top 11-20: - #11: Fred46 189310 #12: lindisita1 151021 #13: Yobiss 142697 #14: AlitaSs 98904 #15: Fernanda16 94755 #16: NN_vOx_exterminio-fiscal 68804 #17: LeCaTwaLk_z 66815 #18: m-bladee 50000 #19: Chiqktrks_- 43194 #20: MorenoAltoyFibrado 29890
[02:57] Serpiente-Marron Tri.5921 Fisica-Quimicaɩda˿Fisicosxcreadoresxdelfaceleradortdebparticulasx?q [02:57] Serpiente-Marron
Tri.5921 Fisica-Quimicaɩda˿Fisicosxcreadoresxdelfaceleradortdebparticulasx?q
[02:57] Serpiente-Marron 1 Pista: ********* * ****** Valor pregunta : 17543 Puntos [02:57] Serpiente-Marron
1 Pista: ********* * ****** Valor pregunta : 17543 Puntos
[02:57] Serpiente-Marron 2 Pista: coc****** * ****** 30 segundos y 17543 Puntos [02:57] Serpiente-Marron
2 Pista: coc****** * ****** 30 segundos y 17543 Puntos
[02:58] Serpiente-Marron 3 Pista: coc***o** * *a**o* 15 segundos y 17543 Puntos [02:58] Serpiente-Marron
3 Pista: coc***o** * *a**o* 15 segundos y 17543 Puntos
[02:58] Serpiente-Marron Tiempo! La respuesta es -> cockcroft��alton <- [02:58] Serpiente-Marron
Tiempo! La respuesta es -> cockcroft��alton <-
[02:58] Serpiente-Marron Please remember this is a FREE service, Please do not complain [02:58] Serpiente-Marron
Please remember this is a FREE service, Please do not complain
[02:58] Serpiente-Marron Tri.17517 CancionesɃheewakka˿Derquieniesp"Millenium"f?f [02:58] Serpiente-Marron
Tri.17517 CancionesɃheewakka˿Derquieniesp"Millenium"f?f
[02:58] Serpiente-Marron 1 Pista: ****** ******** Valor pregunta : 9078 Puntos [02:58] Serpiente-Marron
1 Pista: ****** ******** Valor pregunta : 9078 Puntos
[02:58] Serpiente-Marron 2 Pista: rob*** ******** 30 segundos y 9078 Puntos [02:58] Serpiente-Marron
2 Pista: rob*** ******** 30 segundos y 9078 Puntos
[02:59] Serpiente-Marron 3 Pista: rob*ie *i**ia** 15 segundos y 9078 Puntos [02:59] Serpiente-Marron
3 Pista: rob*ie *i**ia** 15 segundos y 9078 Puntos
[02:59] Serpiente-Marron Tiempo! La respuesta es -> robbie�illiams <- [02:59] Serpiente-Marron
Tiempo! La respuesta es -> robbie�illiams <-
[02:59] Cocodrilo-Naranja ¦ Emitiendo ( elvigilante ) | Lugar ( Puerto Rico ) | Temática ( Musica Variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Pide tu canción comando: .tocame Tema-Artista [02:59] Cocodrilo-Naranja
¦ Emitiendo ( elvigilante ) | Lugar ( Puerto Rico ) | Temática ( Musica Variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Pide tu canción comando: .tocame Tema-Artista
[02:59] Serpiente-Marron This MONTHS Top 11-20: - #11: KaZuMa_KiRyU 557750 #12: wilby 339535 #13: Ketzy 308075 #14: kitana_- 244720 #15: NN_vOx_Musulprogres 160581 #16: lindisita1 151021 #17: Yobiss 142697 #18: Abril- 107146 #19: AlitaSs 98904 #20: Fernanda16 94755 [02:59] Serpiente-Marron
This MONTHS Top 11-20: - #11: KaZuMa_KiRyU 557750 #12: wilby 339535 #13: Ketzy 308075 #14: kitana_- 244720 #15: NN_vOx_Musulprogres 160581 #16: lindisita1 151021 #17: Yobiss 142697 #18: Abril- 107146 #19: AlitaSs 98904 #20: Fernanda16 94755
[02:59] Serpiente-Marron Tri.17860 Personajesɑuim˿LaznovelistazyydirectorazMargueritecDurasterazfrancesa,xperoqentqu郰1xciudadpnaci󃰱x?x [02:59] Serpiente-Marron
Tri.17860 Personajesɑuim˿LaznovelistazyydirectorazMargueritecDurasterazfrancesa,xperoqentqu郰1xciudadpnaci󃰱x?x
[02:59] Serpiente-Marron 1 Pista: ****** Valor pregunta : 6531 Puntos [02:59] Serpiente-Marron
1 Pista: ****** Valor pregunta : 6531 Puntos
[02:59] Serpiente-Marron 2 Pista: sai*** 30 segundos y 6531 Puntos [02:59] Serpiente-Marron
2 Pista: sai*** 30 segundos y 6531 Puntos
[02:59] Culebra{Naranja saigon [02:59] Culebra{Naranja
saigon
[02:59] Serpiente-Marron �Bien Culebra{Naranja!! Tu respuesta: "saigon" es correcta y ganas �531�12 puntos [02:59] Serpiente-Marron
�Bien Culebra{Naranja!! Tu respuesta: "saigon" es correcta y ganas �531�12 puntos
[02:59] Serpiente-Marron Culebra{Naranja has acertado 25 seguidas!! Puntos HOY: 81531, SEMANA: 8350257 y MES: 14868821 [02:59] Serpiente-Marron
Culebra{Naranja has acertado 25 seguidas!! Puntos HOY: 81531, SEMANA: 8350257 y MES: 14868821
[02:59] Serpiente-Marron 25 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [02:59] Serpiente-Marron
25 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:00] Serpiente-Marron R᮫ing �ltima SEMANA: #1: Culebra{Naranja 10483560 #2: Gladiadora_del_Caribe 6590569 #3: siva- 4847579 [03:00] Serpiente-Marron
R᮫ing �ltima SEMANA: #1: Culebra{Naranja 10483560 #2: Gladiadora_del_Caribe 6590569 #3: siva- 4847579
[03:00] Serpiente-Marron Tri.10418 BiologiaɃyBeRLoKa˿CӍOmSEmLLAMAmELmPOLISAC�IDOmCOMPLEJOmQUEmIMPIDEmLAmFORMACIӎmDEmTROMBOSmENmLOSmVASOSmSANGU͎EOS?m?m [03:00] Serpiente-Marron
Tri.10418 BiologiaɃyBeRLoKa˿CӍOmSEmLLAMAmELmPOLISAC�IDOmCOMPLEJOmQUEmIMPIDEmLAmFORMACIӎmDEmTROMBOSmENmLOSmVASOSmSANGU͎EOS?m?m
[03:00] Serpiente-Marron 1 Pista: ******** Valor pregunta : 11230 Puntos [03:00] Serpiente-Marron
1 Pista: ******** Valor pregunta : 11230 Puntos
[03:00] Serpiente-Marron 2 Pista: hep***** 30 segundos y 11230 Puntos [03:00] Serpiente-Marron
2 Pista: hep***** 30 segundos y 11230 Puntos
[03:00] Serpiente-Marron 3 Pista: hepa*i*a 15 segundos y 11230 Puntos [03:00] Serpiente-Marron
3 Pista: hepa*i*a 15 segundos y 11230 Puntos
[03:00] Serpiente-Marron Tiempo! La respuesta es -> heparina <- [03:00] Serpiente-Marron
Tiempo! La respuesta es -> heparina <-
[03:01] Serpiente-Marron Top10 Players ( Weekly & Monthly ) are Auto-Voiced [03:01] Serpiente-Marron
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[03:01] Serpiente-Marron Tri.2233 MitologiaɎAPINE˿DIVINIDADvGRIEGAvQUEvPERSONIFICAvELvPUDORv?v [03:01] Serpiente-Marron
Tri.2233 MitologiaɎAPINE˿DIVINIDADvGRIEGAvQUEvPERSONIFICAvELvPUDORv?v
[03:01] Serpiente-Marron 1 Pista: ***** Valor pregunta : 8400 Puntos [03:01] Serpiente-Marron
1 Pista: ***** Valor pregunta : 8400 Puntos
[03:01] Serpiente-Marron 2 Pista: aid** 30 segundos y 8400 Puntos [03:01] Serpiente-Marron
2 Pista: aid** 30 segundos y 8400 Puntos
[03:01] Serpiente-Marron 3 Pista: aido* 15 segundos y 8400 Puntos [03:01] Serpiente-Marron
3 Pista: aido* 15 segundos y 8400 Puntos
[03:01] Serpiente-Marron Tiempo! La respuesta es -> aidos <- [03:01] Serpiente-Marron
Tiempo! La respuesta es -> aidos <-
[03:01] Serpiente-Marron Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [03:01] Serpiente-Marron
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[03:01] Serpiente-Marron Tri.3446 GeografiaɁWELETE˿DONDEeESTAeELeARCOeDEeARREBATACAPASe?e [03:01] Serpiente-Marron
Tri.3446 GeografiaɁWELETE˿DONDEeESTAeELeARCOeDEeARREBATACAPASe?e
[03:01] Serpiente-Marron 1 Pista: ******* Valor pregunta : 13177 Puntos [03:01] Serpiente-Marron
1 Pista: ******* Valor pregunta : 13177 Puntos
[03:02] Serpiente-Marron 2 Pista: ati**** 30 segundos y 13177 Puntos [03:02] Serpiente-Marron
2 Pista: ati**** 30 segundos y 13177 Puntos
[03:02] Serpiente-Marron 3 Pista: atie**a 15 segundos y 13177 Puntos [03:02] Serpiente-Marron
3 Pista: atie**a 15 segundos y 13177 Puntos
[03:02] Serpiente-Marron Tiempo! La respuesta es -> atienza <- [03:02] Serpiente-Marron
Tiempo! La respuesta es -> atienza <-
[03:02] Serpiente-Marron R᮫ing SEMANA: - #1: Culebra{Naranja 8350257 #2: Gladiadora_del_Caribe 6723585 #3: CAP2630 2205895 #4: Sirena__ 1107842 #5: Alii 1036251 #6: siva- 530841 #7: Cosmo 427307 #8: Ketzy 308075 #9: KaZuMa_KiRyU 230692 #10: kitana_- 213209 [03:02] Serpiente-Marron
R᮫ing SEMANA: - #1: Culebra{Naranja 8350257 #2: Gladiadora_del_Caribe 6723585 #3: CAP2630 2205895 #4: Sirena__ 1107842 #5: Alii 1036251 #6: siva- 530841 #7: Cosmo 427307 #8: Ketzy 308075 #9: KaZuMa_KiRyU 230692 #10: kitana_- 213209
[03:02] Serpiente-Marron Tri.4663 Informaticaɥldanas˓oftware:xCualoeshelolenguajeqdeqprogramacionnmashdifundidoaynmashportableq?x?x [03:02] Serpiente-Marron
Tri.4663 Informaticaɥldanas˓oftware:xCualoeshelolenguajeqdeqprogramacionnmashdifundidoaynmashportableq?x?x
[03:02] Serpiente-Marron 1 Pista: * Valor pregunta : 21457 Puntos [03:02] Serpiente-Marron
1 Pista: * Valor pregunta : 21457 Puntos
[03:03] Serpiente-Marron 2 Pista: c 30 segundos y 21457 Puntos [03:03] Serpiente-Marron
2 Pista: c 30 segundos y 21457 Puntos
[03:03] Culebra{Naranja c [03:03] Culebra{Naranja
c
[03:03] Serpiente-Marron �As�e hace Culebra{Naranja!! Contestaste "c" en �4.109 segundos y sumas �1457�12 puntos [03:03] Serpiente-Marron
�As�e hace Culebra{Naranja!! Contestaste "c" en �4.109 segundos y sumas �1457�12 puntos
[03:03] Serpiente-Marron Culebra{Naranja has acertado 26 seguidas!! Puntos HOY: 102988, SEMANA: 8371714 y MES: 14890278 [03:03] Serpiente-Marron
Culebra{Naranja has acertado 26 seguidas!! Puntos HOY: 102988, SEMANA: 8371714 y MES: 14890278
[03:03] Serpiente-Marron 26 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:03] Serpiente-Marron
26 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:03] Serpiente-Marron We feature over 50,000 Q&A ! [03:03] Serpiente-Marron
We feature over 50,000 Q&A !
[03:03] Serpiente-Marron Tri.451 Fisica-QuimicaɉRC-Domain˿Ahcuantoscwatioscequivalenr33dbMh(enrnumero)?h?h [03:03] Serpiente-Marron
Tri.451 Fisica-QuimicaɉRC-Domain˿Ahcuantoscwatioscequivalenr33dbMh(enrnumero)?h?h
[03:03] Serpiente-Marron 1 Pista: * Valor pregunta : 22249 Puntos [03:03] Serpiente-Marron
1 Pista: * Valor pregunta : 22249 Puntos
[03:03] Serpiente-Marron 2 Pista: 2 30 segundos y 22249 Puntos [03:03] Serpiente-Marron
2 Pista: 2 30 segundos y 22249 Puntos
[03:03] Culebra{Naranja 2 [03:03] Culebra{Naranja
2
[03:03] Serpiente-Marron �Est᳠que lo tiras Culebra{Naranja!! ߃󭯠supiste que "2" era la respuesta? Venga, �2249�12 puntos suben a tu marcador [03:03] Serpiente-Marron
�Est᳠que lo tiras Culebra{Naranja!! ߃󭯠supiste que "2" era la respuesta? Venga, �2249�12 puntos suben a tu marcador
[03:03] Serpiente-Marron Culebra{Naranja has acertado 27 seguidas!! Puntos HOY: 125237, SEMANA: 8393963 y MES: 14912527 [03:03] Serpiente-Marron
Culebra{Naranja has acertado 27 seguidas!! Puntos HOY: 125237, SEMANA: 8393963 y MES: 14912527
[03:03] Serpiente-Marron 27 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:03] Serpiente-Marron
27 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:03] Serpiente-Marron Tri.2080 Deporteɲaziel9˿BALONCESTO:ENgQUEgEQUIPOgESTABAgENg2003/04gELgJUGADORgNACHOgAZOFRAg?g [03:03] Serpiente-Marron
Tri.2080 Deporteɲaziel9˿BALONCESTO:ENgQUEgEQUIPOgESTABAgENg2003/04gELgJUGADORgNACHOgAZOFRAg?g
[03:03] Serpiente-Marron 1 Pista: ****** *********** Valor pregunta : 21101 Puntos [03:03] Serpiente-Marron
1 Pista: ****** *********** Valor pregunta : 21101 Puntos
[03:04] Serpiente-Marron 2 Pista: ade*** *********** 30 segundos y 21101 Puntos [03:04] Serpiente-Marron
2 Pista: ade*** *********** 30 segundos y 21101 Puntos
[03:04] Serpiente-Marron 3 Pista: ade**o e**u*ia**e* 15 segundos y 21101 Puntos [03:04] Serpiente-Marron
3 Pista: ade**o e**u*ia**e* 15 segundos y 21101 Puntos
[03:04] Serpiente-Marron Tiempo! La respuesta es -> adecco�studiantes <- [03:04] Serpiente-Marron
Tiempo! La respuesta es -> adecco�studiantes <-
[03:04] Serpiente-Marron Tri.18211 Fisica-QuimicaɃasiopea˿CuantosymillonesydeytoneladasydeyhidrogenojquemawelqSolqpordsegundoj?c [03:04] Serpiente-Marron
Tri.18211 Fisica-QuimicaɃasiopea˿CuantosymillonesydeytoneladasydeyhidrogenojquemawelqSolqpordsegundoj?c
[03:04] Serpiente-Marron 1 Pista: *********** Pregunta de BONUS : 100000 Puntos [03:04] Serpiente-Marron
1 Pista: *********** Pregunta de BONUS : 100000 Puntos
[03:05] Serpiente-Marron 2 Pista: sei******** 30 segundos y 100000 Puntos [03:05] Serpiente-Marron
2 Pista: sei******** 30 segundos y 100000 Puntos
[03:05] Serpiente-Marron 3 Pista: sei**ie**o* 15 segundos y 100000 Puntos [03:05] Serpiente-Marron
3 Pista: sei**ie**o* 15 segundos y 100000 Puntos
[03:05] Culebra{Naranja seiscientos [03:05] Culebra{Naranja
seiscientos
[03:05] Serpiente-Marron �Bien Culebra{Naranja!! Tu respuesta: "seiscientos" es correcta y ganas �00000�12 puntos [03:05] Serpiente-Marron
�Bien Culebra{Naranja!! Tu respuesta: "seiscientos" es correcta y ganas �00000�12 puntos
[03:05] Serpiente-Marron Culebra{Naranja has acertado 28 seguidas!! Puntos HOY: 225237, SEMANA: 8493963 y MES: 15012527 [03:05] Serpiente-Marron
Culebra{Naranja has acertado 28 seguidas!! Puntos HOY: 225237, SEMANA: 8493963 y MES: 15012527
[03:05] Serpiente-Marron 28 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:05] Serpiente-Marron
28 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:05] Serpiente-Marron Please remember this is a FREE service, Please do not complain [03:05] Serpiente-Marron
Please remember this is a FREE service, Please do not complain
[03:05] Serpiente-Marron Tri.8875 Gastronomiaɍercedes˿Lalcarneadeaqueaanimaledeacazaleralempleadalenwunwguisochuertano.....a?a [03:05] Serpiente-Marron
Tri.8875 Gastronomiaɍercedes˿Lalcarneadeaqueaanimaledeacazaleralempleadalenwunwguisochuertano.....a?a
[03:05] Serpiente-Marron 1 Pista: ****** Valor pregunta : 11805 Puntos [03:05] Serpiente-Marron
1 Pista: ****** Valor pregunta : 11805 Puntos
[03:05] Serpiente-Marron 2 Pista: fai*** 30 segundos y 11805 Puntos [03:05] Serpiente-Marron
2 Pista: fai*** 30 segundos y 11805 Puntos
[03:06] Serpiente-Marron 3 Pista: fai*a* 15 segundos y 11805 Puntos [03:06] Serpiente-Marron
3 Pista: fai*a* 15 segundos y 11805 Puntos
[03:06] Culebra{Naranja faisan [03:06] Culebra{Naranja
faisan
[03:06] Serpiente-Marron �Ol頃04Culebra{Naranja!! Has contestado: "faisan" en �7.781 segundos y sumas �1805�12 puntos a tu marcador. �Sigue as� [03:06] Serpiente-Marron
�Ol頃04Culebra{Naranja!! Has contestado: "faisan" en �7.781 segundos y sumas �1805�12 puntos a tu marcador. �Sigue as�
[03:06] Serpiente-Marron Culebra{Naranja has acertado 29 seguidas!! Puntos HOY: 237042, SEMANA: 8505768 y MES: 15024332 [03:06] Serpiente-Marron
Culebra{Naranja has acertado 29 seguidas!! Puntos HOY: 237042, SEMANA: 8505768 y MES: 15024332
[03:06] Serpiente-Marron 29 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:06] Serpiente-Marron
29 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:06] Serpiente-Marron R᮫ing �ltimo MES: #1: Culebra{Naranja 52886387 #2: Gladiadora_del_Caribe 23128897 #3: Flamenco}Eficiente 15623946 #4: siva- 10800261 #5: Guiarte_Yo 2584013 [03:06] Serpiente-Marron
R᮫ing �ltimo MES: #1: Culebra{Naranja 52886387 #2: Gladiadora_del_Caribe 23128897 #3: Flamenco}Eficiente 15623946 #4: siva- 10800261 #5: Guiarte_Yo 2584013
[03:06] Serpiente-Marron Tri.8702 ArteɁttica˿Bastidorodevmaderaequevsirvevparaeteneroeltpapeltestiradotengeltdibujo?r?r [03:06] Serpiente-Marron
Tri.8702 ArteɁttica˿Bastidorodevmaderaequevsirvevparaeteneroeltpapeltestiradotengeltdibujo?r?r
[03:06] Serpiente-Marron 1 Pista: ********* Valor pregunta : 24529 Puntos [03:06] Serpiente-Marron
1 Pista: ********* Valor pregunta : 24529 Puntos
[03:06] Serpiente-Marron 2 Pista: est****** 30 segundos y 24529 Puntos [03:06] Serpiente-Marron
2 Pista: est****** 30 segundos y 24529 Puntos
[03:06] Serpiente-Marron 3 Pista: esti*a*o* 15 segundos y 24529 Puntos [03:06] Serpiente-Marron
3 Pista: esti*a*o* 15 segundos y 24529 Puntos
[03:07] Culebra{Naranja estirador [03:07] Culebra{Naranja
estirador
[03:07] Serpiente-Marron �Absolutamente correcto Culebra{Naranja!! Acertaste "estirador" en �6.125 segundos y ganas �4529�12 puntos [03:07] Serpiente-Marron
�Absolutamente correcto Culebra{Naranja!! Acertaste "estirador" en �6.125 segundos y ganas �4529�12 puntos
[03:07] Serpiente-Marron Culebra{Naranja has acertado 30 seguidas!! Puntos HOY: 261571, SEMANA: 8530297 y MES: 15048861 [03:07] Serpiente-Marron
Culebra{Naranja has acertado 30 seguidas!! Puntos HOY: 261571, SEMANA: 8530297 y MES: 15048861
[03:07] Serpiente-Marron Bonus especial de 80000 Puntos para Culebra{Naranja por acertar 30 seguidas!!! [03:07] Serpiente-Marron
Bonus especial de 80000 Puntos para Culebra{Naranja por acertar 30 seguidas!!!
[03:07] Serpiente-Marron 30 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:07] Serpiente-Marron
30 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:07] Serpiente-Marron If you think a Q&A is wrong, please call an OP [03:07] Serpiente-Marron
If you think a Q&A is wrong, please call an OP
[03:07] Serpiente-Marron Tri.8384 Medicina-SaludɃygna˿C󭯃01hsenllamaoelfreplieguendenperitoneohquenrecubrenelfintestino?a?a [03:07] Serpiente-Marron
Tri.8384 Medicina-SaludɃygna˿C󭯃01hsenllamaoelfreplieguendenperitoneohquenrecubrenelfintestino?a?a
[03:07] Serpiente-Marron 1 Pista: ******* Pregunta de BONUS : 50000 Puntos [03:07] Serpiente-Marron
1 Pista: ******* Pregunta de BONUS : 50000 Puntos
[03:07] Serpiente-Marron 2 Pista: epi**** 30 segundos y 50000 Puntos [03:07] Serpiente-Marron
2 Pista: epi**** 30 segundos y 50000 Puntos
[03:07] Serpiente-Marron 3 Pista: epi**o* 15 segundos y 50000 Puntos [03:07] Serpiente-Marron
3 Pista: epi**o* 15 segundos y 50000 Puntos
[03:07] Serpiente-Marron Tiempo! La respuesta es -> epiplon <- [03:07] Serpiente-Marron
Tiempo! La respuesta es -> epiplon <-
[03:08] Serpiente-Marron R᮫ing por D́: - Domingo: Gladiadora_del_Caribe 1799967 Lunes: CAP2630 2205895 Martes: Culebra{Naranja 1914185 Miercoles: Culebra{Naranja 1715545 Jueves: Culebra{Naranja 1769462 Viernes: Gladiadora_del_Caribe 1992978 Sᢡdo: Gladiadora_del_Caribe 1324395 [03:08] Serpiente-Marron
R᮫ing por D́: - Domingo: Gladiadora_del_Caribe 1799967 Lunes: CAP2630 2205895 Martes: Culebra{Naranja 1914185 Miercoles: Culebra{Naranja 1715545 Jueves: Culebra{Naranja 1769462 Viernes: Gladiadora_del_Caribe 1992978 Sᢡdo: Gladiadora_del_Caribe 1324395
[03:08] Serpiente-Marron Tri.12656 Fisica-QuimicaɃort˿ComooSEmLLAMAmLAmLEYmQUEmESTABLECEmLAmRELACIӎmENTREmLAmFUERZAmAPLICADAmAmUNmRESORTEmYmLAmELONGACIӎmPROVOCADAmPORmLAmACCIӎmDEmESAmFUERZAm?m [03:08] Serpiente-Marron
Tri.12656 Fisica-QuimicaɃort˿ComooSEmLLAMAmLAmLEYmQUEmESTABLECEmLAmRELACIӎmENTREmLAmFUERZAmAPLICADAmAmUNmRESORTEmYmLAmELONGACIӎmPROVOCADAmPORmLAmACCIӎmDEmESAmFUERZAm?m
[03:08] Serpiente-Marron 1 Pista: *** ** ***** Valor pregunta : 5446 Puntos [03:08] Serpiente-Marron
1 Pista: *** ** ***** Valor pregunta : 5446 Puntos
[03:08] Serpiente-Marron 2 Pista: ley ** ***** 30 segundos y 5446 Puntos [03:08] Serpiente-Marron
2 Pista: ley ** ***** 30 segundos y 5446 Puntos
[03:08] Serpiente-Marron 3 Pista: ley *e *oo*e 15 segundos y 5446 Puntos [03:08] Serpiente-Marron
3 Pista: ley *e *oo*e 15 segundos y 5446 Puntos
[03:08] Serpiente-Marron Tiempo! La respuesta es -> ley�e�ooke <- [03:08] Serpiente-Marron
Tiempo! La respuesta es -> ley�e�ooke <-
[03:09] Serpiente-Marron For The Competitive Edge type !pingme [03:09] Serpiente-Marron
For The Competitive Edge type !pingme
[03:09] Serpiente-Marron Tri.10738 Cotilleo-TVɍARdeJAVA˿ENoQUɃ01oPROGRAMAoDEoTELEo5oAPAREĆoELo"CHINOoCUDEIRO"oYoUNoMONTӎoDEoJAPONESESoSOMETIɎDOSEoAoDURASoPRUEBASoYoD�DOSEoPIяS?o?o [03:09] Serpiente-Marron
Tri.10738 Cotilleo-TVɍARdeJAVA˿ENoQUɃ01oPROGRAMAoDEoTELEo5oAPAREĆoELo"CHINOoCUDEIRO"oYoUNoMONTӎoDEoJAPONESESoSOMETIɎDOSEoAoDURASoPRUEBASoYoD�DOSEoPIяS?o?o
[03:09] Serpiente-Marron 1 Pista: ***** ******** Valor pregunta : 12239 Puntos [03:09] Serpiente-Marron
1 Pista: ***** ******** Valor pregunta : 12239 Puntos
[03:09] Serpiente-Marron 2 Pista: hum** ******** 30 segundos y 12239 Puntos [03:09] Serpiente-Marron
2 Pista: hum** ******** 30 segundos y 12239 Puntos
[03:09] Serpiente-Marron 3 Pista: humo* a*a*i**o 15 segundos y 12239 Puntos [03:09] Serpiente-Marron
3 Pista: humo* a*a*i**o 15 segundos y 12239 Puntos
[03:09] Serpiente-Marron Tiempo! La respuesta es -> humor�marillo <- [03:09] Serpiente-Marron
Tiempo! La respuesta es -> humor�marillo <-
[03:10] Serpiente-Marron Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [03:10] Serpiente-Marron
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[03:10] Serpiente-Marron Tri.3189 IdiomasɂRUJI˿DISCURSObMILITARbObPOLITICObCONbANIMObDEbENARDECERbALbPUBLICOb?b [03:10] Serpiente-Marron
Tri.3189 IdiomasɂRUJI˿DISCURSObMILITARbObPOLITICObCONbANIMObDEbENARDECERbALbPUBLICOb?b
[03:10] Serpiente-Marron 1 Pista: ****** Valor pregunta : 15227 Puntos [03:10] Serpiente-Marron
1 Pista: ****** Valor pregunta : 15227 Puntos
[03:10] Serpiente-Marron 2 Pista: are*** 30 segundos y 15227 Puntos [03:10] Serpiente-Marron
2 Pista: are*** 30 segundos y 15227 Puntos
[03:10] Serpiente-Marron 3 Pista: are**a 15 segundos y 15227 Puntos [03:10] Serpiente-Marron
3 Pista: are**a 15 segundos y 15227 Puntos
[03:10] Serpiente-Marron Tiempo! La respuesta es -> arenga <- [03:10] Serpiente-Marron
Tiempo! La respuesta es -> arenga <-
[03:10] Serpiente-Marron R᮫ing MES: - #1: Culebra{Naranja 15128861 #2: Gladiadora_del_Caribe 11737007 #3: siva- 2676459 #4: Fred46 2616141 #5: CAP2632 2481083 #6: CAP2630 2205895 #7: Sirena__ 1241518 #8: Alii 1036251 #9: Cosmo 1009399 #10: MorenoAltoyFibrado 886845 [03:10] Serpiente-Marron
R᮫ing MES: - #1: Culebra{Naranja 15128861 #2: Gladiadora_del_Caribe 11737007 #3: siva- 2676459 #4: Fred46 2616141 #5: CAP2632 2481083 #6: CAP2630 2205895 #7: Sirena__ 1241518 #8: Alii 1036251 #9: Cosmo 1009399 #10: MorenoAltoyFibrado 886845
[03:10] Serpiente-Marron Tri.14190 CancionesɌitening˿Conuqui鮃01uhizouManolouGarc�01kunakversi󮃰1udey"Insurrecci󮢿x?x [03:10] Serpiente-Marron
Tri.14190 CancionesɌitening˿Conuqui鮃01uhizouManolouGarc�01kunakversi󮃰1udey"Insurrecci󮢿x?x
[03:10] Serpiente-Marron 1 Pista: ****** **** Valor pregunta : 13987 Puntos [03:10] Serpiente-Marron
1 Pista: ****** **** Valor pregunta : 13987 Puntos
[03:11] Serpiente-Marron 2 Pista: mig*** **** 30 segundos y 13987 Puntos [03:11] Serpiente-Marron
2 Pista: mig*** **** 30 segundos y 13987 Puntos
[03:11] Serpiente-Marron 3 Pista: migue* *io* 15 segundos y 13987 Puntos [03:11] Serpiente-Marron
3 Pista: migue* *io* 15 segundos y 13987 Puntos
[03:11] Culebra{Naranja miguel rios [03:11] Culebra{Naranja
miguel rios
[03:11] Serpiente-Marron �Increible!! Culebra{Naranja contest󺠃04"miguel rios" en �8.688 segundos, y ha ganado �3987�12 puntos [03:11] Serpiente-Marron
�Increible!! Culebra{Naranja contest󺠃04"miguel rios" en �8.688 segundos, y ha ganado �3987�12 puntos
[03:11] Serpiente-Marron Culebra{Naranja has acertado 31 seguidas!! Puntos HOY: 355558, SEMANA: 8624284 y MES: 15142848 [03:11] Serpiente-Marron
Culebra{Naranja has acertado 31 seguidas!! Puntos HOY: 355558, SEMANA: 8624284 y MES: 15142848
[03:11] Serpiente-Marron 31 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:11] Serpiente-Marron
31 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:11] Serpiente-Marron Please refrain from using Extreme Bad Language [03:11] Serpiente-Marron
Please refrain from using Extreme Bad Language
[03:11] Serpiente-Marron Tri.6646 Biologiaɳica˿Cualjesqeljinsectokmasqvelozc?c [03:11] Serpiente-Marron
Tri.6646 Biologiaɳica˿Cualjesqeljinsectokmasqvelozc?c
[03:11] Serpiente-Marron 1 Pista: *********** *** ****** Valor pregunta : 19148 Puntos [03:11] Serpiente-Marron
1 Pista: *********** *** ****** Valor pregunta : 19148 Puntos
[03:11] Serpiente-Marron 2 Pista: cut******** *** ****** 30 segundos y 19148 Puntos [03:11] Serpiente-Marron
2 Pista: cut******** *** ****** 30 segundos y 19148 Puntos
[03:12] Serpiente-Marron 3 Pista: cute*e**i*o *e* *ie**o 15 segundos y 19148 Puntos [03:12] Serpiente-Marron
3 Pista: cute*e**i*o *e* *ie**o 15 segundos y 19148 Puntos
[03:12] Serpiente-Marron Tiempo! La respuesta es -> cuterebrido�el�iervo <- [03:12] Serpiente-Marron
Tiempo! La respuesta es -> cuterebrido�el�iervo <-
[03:12] Serpiente-Marron This is #Mexico, I am your host Serpiente-Marron, running Serpiente-Marron [03:12] Serpiente-Marron
This is #Mexico, I am your host Serpiente-Marron, running Serpiente-Marron
[03:12] Serpiente-Marron Tri.1098 Gastronomiaɒolo˿ComoiserllamaylaymezclayderNaranjayykVodkay?z [03:12] Serpiente-Marron
Tri.1098 Gastronomiaɒolo˿ComoiserllamaylaymezclayderNaranjayykVodkay?z
[03:12] Serpiente-Marron 1 Pista: ************** Valor pregunta : 14350 Puntos [03:12] Serpiente-Marron
1 Pista: ************** Valor pregunta : 14350 Puntos
[03:12] Serpiente-Marron 2 Pista: DES*********** 30 segundos y 14350 Puntos [03:12] Serpiente-Marron
2 Pista: DES*********** 30 segundos y 14350 Puntos
[03:13] Serpiente-Marron 3 Pista: DES*O**I**A*O* 15 segundos y 14350 Puntos [03:13] Serpiente-Marron
3 Pista: DES*O**I**A*O* 15 segundos y 14350 Puntos
[03:13] Serpiente-Marron Tiempo! La respuesta es -> DESTORNILLADOR <- [03:13] Serpiente-Marron
Tiempo! La respuesta es -> DESTORNILLADOR <-
[03:13] Serpiente-Marron This WEEKS Top 11-20: - #11: Fred46 189310 #12: lindisita1 151021 #13: Yobiss 142697 #14: AlitaSs 98904 #15: Fernanda16 94755 #16: NN_vOx_exterminio-fiscal 68804 #17: LeCaTwaLk_z 66815 #18: m-bladee 50000 #19: Chiqktrks_- 43194 #20: MorenoAltoyFibrado 29890 [03:13] Serpiente-Marron
This WEEKS Top 11-20: - #11: Fred46 189310 #12: lindisita1 151021 #13: Yobiss 142697 #14: AlitaSs 98904 #15: Fernanda16 94755 #16: NN_vOx_exterminio-fiscal 68804 #17: LeCaTwaLk_z 66815 #18: m-bladee 50000 #19: Chiqktrks_- 43194 #20: MorenoAltoyFibrado 29890
[03:13] Serpiente-Marron Tri.15765 EconomiaɊarreando˿C󭯃01nsesdenominazazlazencuestazperi󤩣azdestinadazalpanᬩsiszdin᭩condesvariableszdesmercado?d?d [03:13] Serpiente-Marron
Tri.15765 EconomiaɊarreando˿C󭯃01nsesdenominazazlazencuestazperi󤩣azdestinadazalpanᬩsiszdin᭩condesvariableszdesmercado?d?d
[03:13] Serpiente-Marron 1 Pista: ***** Valor pregunta : 18801 Puntos [03:13] Serpiente-Marron
1 Pista: ***** Valor pregunta : 18801 Puntos
[03:13] Serpiente-Marron 2 Pista: pan** 30 segundos y 18801 Puntos [03:13] Serpiente-Marron
2 Pista: pan** 30 segundos y 18801 Puntos
[03:14] Serpiente-Marron 3 Pista: pane* 15 segundos y 18801 Puntos [03:14] Serpiente-Marron
3 Pista: pane* 15 segundos y 18801 Puntos
[03:14] Serpiente-Marron Tiempo! La respuesta es -> panel <- [03:14] Serpiente-Marron
Tiempo! La respuesta es -> panel <-
[03:14] Cocodrilo-Naranja ¦ Emitiendo ( elvigilante ) | Lugar ( Puerto Rico ) | Temática ( Musica Variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Pide tu canción comando: .tocame Tema-Artista [03:14] Cocodrilo-Naranja
¦ Emitiendo ( elvigilante ) | Lugar ( Puerto Rico ) | Temática ( Musica Variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Pide tu canción comando: .tocame Tema-Artista
[03:14] Serpiente-Marron Please remember this is a FREE service, Please do not complain [03:14] Serpiente-Marron
Please remember this is a FREE service, Please do not complain
[03:14] Serpiente-Marron Tri.11930 Cineɬusie˿ActorfquestienententcomuntDulceshogar...cayvecespypMigIdahonprivadon?c [03:14] Serpiente-Marron
Tri.11930 Cineɬusie˿ActorfquestienententcomuntDulceshogar...cayvecespypMigIdahonprivadon?c
[03:14] Serpiente-Marron 1 Pista: ***** ****** Valor pregunta : 24673 Puntos [03:14] Serpiente-Marron
1 Pista: ***** ****** Valor pregunta : 24673 Puntos
[03:14] Serpiente-Marron 2 Pista: kea** ****** 30 segundos y 24673 Puntos [03:14] Serpiente-Marron
2 Pista: kea** ****** 30 segundos y 24673 Puntos
[03:15] Serpiente-Marron 3 Pista: kea*u *ee*e* 15 segundos y 24673 Puntos [03:15] Serpiente-Marron
3 Pista: kea*u *ee*e* 15 segundos y 24673 Puntos
[03:15] Serpiente-Marron Tiempo! La respuesta es -> keanu�eeves <- [03:15] Serpiente-Marron
Tiempo! La respuesta es -> keanu�eeves <-
[03:15] Serpiente-Marron This MONTHS Top 11-20: - #11: KaZuMa_KiRyU 557750 #12: wilby 339535 #13: Ketzy 308075 #14: kitana_- 244720 #15: NN_vOx_Musulprogres 160581 #16: lindisita1 151021 #17: Yobiss 142697 #18: Abril- 107146 #19: AlitaSs 98904 #20: Fernanda16 94755 [03:15] Serpiente-Marron
This MONTHS Top 11-20: - #11: KaZuMa_KiRyU 557750 #12: wilby 339535 #13: Ketzy 308075 #14: kitana_- 244720 #15: NN_vOx_Musulprogres 160581 #16: lindisita1 151021 #17: Yobiss 142697 #18: Abril- 107146 #19: AlitaSs 98904 #20: Fernanda16 94755
[03:15] Serpiente-Marron Tri.8584 Miscelaneaɓebosin˿(Adivinanzas)Soyyconsultorfdehlaskdamaskyyporfellaskmuyyquerido,knuncavhablorlavverdadwnizenimentiravmehhanicogido?k?k [03:15] Serpiente-Marron
Tri.8584 Miscelaneaɓebosin˿(Adivinanzas)Soyyconsultorfdehlaskdamaskyyporfellaskmuyyquerido,knuncavhablorlavverdadwnizenimentiravmehhanicogido?k?k
[03:15] Serpiente-Marron 1 Pista: ****** Valor pregunta : 24401 Puntos [03:15] Serpiente-Marron
1 Pista: ****** Valor pregunta : 24401 Puntos
[03:15] Serpiente-Marron 2 Pista: esp*** 30 segundos y 24401 Puntos [03:15] Serpiente-Marron
2 Pista: esp*** 30 segundos y 24401 Puntos
[03:15] Serpiente-Marron 3 Pista: espe*o 15 segundos y 24401 Puntos [03:15] Serpiente-Marron
3 Pista: espe*o 15 segundos y 24401 Puntos
[03:16] Culebra{Naranja espejo [03:16] Culebra{Naranja
espejo
[03:16] Serpiente-Marron �Bien Culebra{Naranja!! Tu respuesta: "espejo" es correcta y ganas �4401�12 puntos [03:16] Serpiente-Marron
�Bien Culebra{Naranja!! Tu respuesta: "espejo" es correcta y ganas �4401�12 puntos
[03:16] Serpiente-Marron Culebra{Naranja has acertado 32 seguidas!! Puntos HOY: 379959, SEMANA: 8648685 y MES: 15167249 [03:16] Serpiente-Marron
Culebra{Naranja has acertado 32 seguidas!! Puntos HOY: 379959, SEMANA: 8648685 y MES: 15167249
[03:16] Serpiente-Marron 32 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:16] Serpiente-Marron
32 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:16] Serpiente-Marron R᮫ing �ltima SEMANA: #1: Culebra{Naranja 10483560 #2: Gladiadora_del_Caribe 6590569 #3: siva- 4847579 [03:16] Serpiente-Marron
R᮫ing �ltima SEMANA: #1: Culebra{Naranja 10483560 #2: Gladiadora_del_Caribe 6590569 #3: siva- 4847579
[03:16] Serpiente-Marron Tri.13749 CineɍARdeJAVAˁNDYvWACHOWSKIvYvLARRYvWACHOWSKIvSONvLOSvDOSvHERMANOSvRESPONSABLESvDEvUNAvRECIENTEvSAGAvDEvPEL̓ULASvDEvCIENCIAvFICCIӎvAvCADAvENTREGAvM�vDECEPCIONANTE.v߃U�?v?v [03:16] Serpiente-Marron
Tri.13749 CineɍARdeJAVAˁNDYvWACHOWSKIvYvLARRYvWACHOWSKIvSONvLOSvDOSvHERMANOSvRESPONSABLESvDEvUNAvRECIENTEvSAGAvDEvPEL̓ULASvDEvCIENCIAvFICCIӎvAvCADAvENTREGAvM�vDECEPCIONANTE.v߃U�?v?v
[03:16] Serpiente-Marron 1 Pista: ****** Pregunta de BONUS : 100000 Puntos [03:16] Serpiente-Marron
1 Pista: ****** Pregunta de BONUS : 100000 Puntos
[03:16] Serpiente-Marron 2 Pista: mat*** 30 segundos y 100000 Puntos [03:16] Serpiente-Marron
2 Pista: mat*** 30 segundos y 100000 Puntos
[03:16] Serpiente-Marron 3 Pista: mat*i* 15 segundos y 100000 Puntos [03:16] Serpiente-Marron
3 Pista: mat*i* 15 segundos y 100000 Puntos
[03:16] Culebra{Naranja matriz [03:16] Culebra{Naranja
matriz
[03:17] Serpiente-Marron Tiempo! La respuesta es -> matrix <- [03:17] Serpiente-Marron
Tiempo! La respuesta es -> matrix <-
[03:17] Serpiente-Marron Top10 Players ( Weekly & Monthly ) are Auto-Voiced [03:17] Serpiente-Marron
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[03:17] Serpiente-Marron Tri.2064 PersonajesɍARdeJAVAːROFESIӎnDEnTRACYnLORDS.n?n [03:17] Serpiente-Marron
Tri.2064 PersonajesɍARdeJAVAːROFESIӎnDEnTRACYnLORDS.n?n
[03:17] Serpiente-Marron 1 Pista: ****** ***** Pregunta de BONUS : 100000 Puntos [03:17] Serpiente-Marron
1 Pista: ****** ***** Pregunta de BONUS : 100000 Puntos
[03:17] Serpiente-Marron 2 Pista: act*** ***** 30 segundos y 100000 Puntos [03:17] Serpiente-Marron
2 Pista: act*** ***** 30 segundos y 100000 Puntos
[03:17] Serpiente-Marron 3 Pista: act*i* *o**o 15 segundos y 100000 Puntos [03:17] Serpiente-Marron
3 Pista: act*i* *o**o 15 segundos y 100000 Puntos
[03:17] Culebra{Naranja actriz porno [03:17] Culebra{Naranja
actriz porno
[03:17] Serpiente-Marron �Absolutamente correcto Culebra{Naranja!! Acertaste "actriz porno" en �2.5 segundos y ganas �00000�12 puntos [03:17] Serpiente-Marron
�Absolutamente correcto Culebra{Naranja!! Acertaste "actriz porno" en �2.5 segundos y ganas �00000�12 puntos
[03:17] Serpiente-Marron Culebra{Naranja has acertado 33 seguidas!! Puntos HOY: 479959, SEMANA: 8748685 y MES: 15267249 [03:17] Serpiente-Marron
Culebra{Naranja has acertado 33 seguidas!! Puntos HOY: 479959, SEMANA: 8748685 y MES: 15267249
[03:17] Serpiente-Marron 33 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:17] Serpiente-Marron
33 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:18] Serpiente-Marron Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [03:18] Serpiente-Marron
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[03:18] Serpiente-Marron Tri.6040 Informaticaɴjmm.com˿Conwqu郰1rotraxempresaxsehfusion󃰱rHPrenwelea񯃰1m2002?r?r [03:18] Serpiente-Marron
Tri.6040 Informaticaɴjmm.com˿Conwqu郰1rotraxempresaxsehfusion󃰱rHPrenwelea񯃰1m2002?r?r
[03:18] Serpiente-Marron 1 Pista: ****** Valor pregunta : 11840 Puntos [03:18] Serpiente-Marron
1 Pista: ****** Valor pregunta : 11840 Puntos
[03:18] Serpiente-Marron 2 Pista: com*** 30 segundos y 11840 Puntos [03:18] Serpiente-Marron
2 Pista: com*** 30 segundos y 11840 Puntos
[03:18] Serpiente-Marron 3 Pista: com*a* 15 segundos y 11840 Puntos [03:18] Serpiente-Marron
3 Pista: com*a* 15 segundos y 11840 Puntos
[03:18] Serpiente-Marron Tiempo! La respuesta es -> compaq <- [03:18] Serpiente-Marron
Tiempo! La respuesta es -> compaq <-
[03:19] Serpiente-Marron R᮫ing SEMANA: - #1: Culebra{Naranja 8748685 #2: Gladiadora_del_Caribe 6723585 #3: CAP2630 2205895 #4: Sirena__ 1107842 #5: Alii 1036251 #6: siva- 530841 #7: Cosmo 427307 #8: Ketzy 308075 #9: KaZuMa_KiRyU 230692 #10: kitana_- 213209 [03:19] Serpiente-Marron
R᮫ing SEMANA: - #1: Culebra{Naranja 8748685 #2: Gladiadora_del_Caribe 6723585 #3: CAP2630 2205895 #4: Sirena__ 1107842 #5: Alii 1036251 #6: siva- 530841 #7: Cosmo 427307 #8: Ketzy 308075 #9: KaZuMa_KiRyU 230692 #10: kitana_- 213209
[03:19] Serpiente-Marron Tri.11617 LiteraturaɔeLaRaNhA˿Autorkdee"maremagnum"m?m [03:19] Serpiente-Marron
Tri.11617 LiteraturaɔeLaRaNhA˿Autorkdee"maremagnum"m?m
[03:19] Serpiente-Marron 1 Pista: ***** ******* Valor pregunta : 24942 Puntos [03:19] Serpiente-Marron
1 Pista: ***** ******* Valor pregunta : 24942 Puntos
[03:19] Serpiente-Marron 2 Pista: jor** ******* 30 segundos y 24942 Puntos [03:19] Serpiente-Marron
2 Pista: jor** ******* 30 segundos y 24942 Puntos
[03:19] Serpiente-Marron 3 Pista: jor*e *ui**e* 15 segundos y 24942 Puntos [03:19] Serpiente-Marron
3 Pista: jor*e *ui**e* 15 segundos y 24942 Puntos
[03:19] Serpiente-Marron Tiempo! La respuesta es -> jorge�uillen <- [03:19] Serpiente-Marron
Tiempo! La respuesta es -> jorge�uillen <-
[03:19] Serpiente-Marron We feature over 50,000 Q&A ! [03:19] Serpiente-Marron
We feature over 50,000 Q&A !
[03:19] Serpiente-Marron Tri.3116 InformaticaɔeLaRaNhA˿EmpresarquehcomercializarelqiPodi?p [03:19] Serpiente-Marron
Tri.3116 InformaticaɔeLaRaNhA˿EmpresarquehcomercializarelqiPodi?p
[03:19] Serpiente-Marron 1 Pista: ***** Valor pregunta : 23543 Puntos [03:19] Serpiente-Marron
1 Pista: ***** Valor pregunta : 23543 Puntos
[03:20] Serpiente-Marron 2 Pista: app** 30 segundos y 23543 Puntos [03:20] Serpiente-Marron
2 Pista: app** 30 segundos y 23543 Puntos
[03:20] Serpiente-Marron 3 Pista: app*e 15 segundos y 23543 Puntos [03:20] Serpiente-Marron
3 Pista: app*e 15 segundos y 23543 Puntos
[03:20] Culebra{Naranja apple [03:20] Culebra{Naranja
apple
[03:20] Serpiente-Marron �Enhorabuena Culebra{Naranja!! Has contestado "apple" y por ello has ganado �3543�12 puntos [03:20] Serpiente-Marron
�Enhorabuena Culebra{Naranja!! Has contestado "apple" y por ello has ganado �3543�12 puntos
[03:20] Serpiente-Marron Culebra{Naranja has acertado 34 seguidas!! Puntos HOY: 503502, SEMANA: 8772228 y MES: 15290792 [03:20] Serpiente-Marron
Culebra{Naranja has acertado 34 seguidas!! Puntos HOY: 503502, SEMANA: 8772228 y MES: 15290792
[03:20] Serpiente-Marron 34 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:20] Serpiente-Marron
34 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:20] Serpiente-Marron Tri.15137 Biologiaɐegaso_R˿ENcQUEcPARTEcDEcLAcCELULAcSEcENCUENTRANcLOScFACTOREScHEREDITARIOSc?c [03:20] Serpiente-Marron
Tri.15137 Biologiaɐegaso_R˿ENcQUEcPARTEcDEcLAcCELULAcSEcENCUENTRANcLOScFACTOREScHEREDITARIOSc?c
[03:20] Serpiente-Marron 1 Pista: ****** Valor pregunta : 9538 Puntos [03:20] Serpiente-Marron
1 Pista: ****** Valor pregunta : 9538 Puntos
[03:20] Serpiente-Marron 2 Pista: nuc*** 30 segundos y 9538 Puntos [03:20] Serpiente-Marron
2 Pista: nuc*** 30 segundos y 9538 Puntos
[03:21] Serpiente-Marron 3 Pista: nuc*eo 15 segundos y 9538 Puntos [03:21] Serpiente-Marron
3 Pista: nuc*eo 15 segundos y 9538 Puntos
[03:21] Serpiente-Marron Tiempo! La respuesta es -> nucleo <- [03:21] Serpiente-Marron
Tiempo! La respuesta es -> nucleo <-
[03:21] Serpiente-Marron Tri.19042 Gastronomiaɓebosin˿Esuparecidocalaespagueti,mperocplanocyhm᳃01uancho?m?m [03:21] Serpiente-Marron
Tri.19042 Gastronomiaɓebosin˿Esuparecidocalaespagueti,mperocplanocyhm᳃01uancho?m?m
[03:21] Serpiente-Marron 1 Pista: ******** Pregunta de BONUS : 50000 Puntos [03:21] Serpiente-Marron
1 Pista: ******** Pregunta de BONUS : 50000 Puntos
[03:21] Serpiente-Marron 2 Pista: tal***** 30 segundos y 50000 Puntos [03:21] Serpiente-Marron
2 Pista: tal***** 30 segundos y 50000 Puntos
[03:22] Serpiente-Marron 3 Pista: tal*a*i* 15 segundos y 50000 Puntos [03:22] Serpiente-Marron
3 Pista: tal*a*i* 15 segundos y 50000 Puntos
[03:22] Culebra{Naranja tallarin [03:22] Culebra{Naranja
tallarin
[03:22] Serpiente-Marron �Suma y sigue Culebra{Naranja!! La respuesta: "tallarin" incrementa tu marcador en �0000�12 puntos [03:22] Serpiente-Marron
�Suma y sigue Culebra{Naranja!! La respuesta: "tallarin" incrementa tu marcador en �0000�12 puntos
[03:22] Serpiente-Marron Culebra{Naranja has acertado 35 seguidas!! Puntos HOY: 553502, SEMANA: 8822228 y MES: 15340792 [03:22] Serpiente-Marron
Culebra{Naranja has acertado 35 seguidas!! Puntos HOY: 553502, SEMANA: 8822228 y MES: 15340792
[03:22] Serpiente-Marron 35 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:22] Serpiente-Marron
35 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:22] Serpiente-Marron Please remember this is a FREE service, Please do not complain [03:22] Serpiente-Marron
Please remember this is a FREE service, Please do not complain
[03:22] Serpiente-Marron Tri.14836 Cotilleo-TVɍARdeJAVA˓ERIESqM͔ICASqDEqTV:q߅NqQUɃ01qESTADOqNORTEAMERICANOqSEqENCONTRABAqELqRANCHOqDEq"LAqPONDEROSA",qJUNTOqALqLAGOqTAHOE,qENqLAqSERIEq"BONANZA"?q?q [03:22] Serpiente-Marron
Tri.14836 Cotilleo-TVɍARdeJAVA˓ERIESqM͔ICASqDEqTV:q߅NqQUɃ01qESTADOqNORTEAMERICANOqSEqENCONTRABAqELqRANCHOqDEq"LAqPONDEROSA",qJUNTOqALqLAGOqTAHOE,qENqLAqSERIEq"BONANZA"?q?q
[03:22] Serpiente-Marron 1 Pista: ****** Valor pregunta : 21104 Puntos [03:22] Serpiente-Marron
1 Pista: ****** Valor pregunta : 21104 Puntos
[03:22] Serpiente-Marron 2 Pista: nev*** 30 segundos y 21104 Puntos [03:22] Serpiente-Marron
2 Pista: nev*** 30 segundos y 21104 Puntos
[03:22] Culebra{Naranja nevada [03:22] Culebra{Naranja
nevada
[03:22] Serpiente-Marron �Absolutamente correcto Culebra{Naranja!! Acertaste "nevada" en �4.469 segundos y ganas �1104�12 puntos [03:22] Serpiente-Marron
�Absolutamente correcto Culebra{Naranja!! Acertaste "nevada" en �4.469 segundos y ganas �1104�12 puntos
[03:22] Serpiente-Marron Culebra{Naranja has acertado 36 seguidas!! Puntos HOY: 574606, SEMANA: 8843332 y MES: 15361896 [03:22] Serpiente-Marron
Culebra{Naranja has acertado 36 seguidas!! Puntos HOY: 574606, SEMANA: 8843332 y MES: 15361896
[03:22] Serpiente-Marron 36 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:22] Serpiente-Marron
36 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:23] Serpiente-Marron R᮫ing �ltimo MES: #1: Culebra{Naranja 52886387 #2: Gladiadora_del_Caribe 23128897 #3: Flamenco}Eficiente 15623946 #4: siva- 10800261 #5: Guiarte_Yo 2584013 [03:23] Serpiente-Marron
R᮫ing �ltimo MES: #1: Culebra{Naranja 52886387 #2: Gladiadora_del_Caribe 23128897 #3: Flamenco}Eficiente 15623946 #4: siva- 10800261 #5: Guiarte_Yo 2584013
[03:23] Serpiente-Marron Tri.2653 Personajesɬusie˿Cuᬃ01xfuekelxcuartoenombrekdekMozart?c(enrespa񯬩c?c [03:23] Serpiente-Marron
Tri.2653 Personajesɬusie˿Cuᬃ01xfuekelxcuartoenombrekdekMozart?c(enrespa񯬩c?c
[03:23] Serpiente-Marron 1 Pista: ****** Valor pregunta : 14109 Puntos [03:23] Serpiente-Marron
1 Pista: ****** Valor pregunta : 14109 Puntos
[03:23] Serpiente-Marron 2 Pista: ama*** 30 segundos y 14109 Puntos [03:23] Serpiente-Marron
2 Pista: ama*** 30 segundos y 14109 Puntos
[03:23] Serpiente-Marron 3 Pista: ama*eo 15 segundos y 14109 Puntos [03:23] Serpiente-Marron
3 Pista: ama*eo 15 segundos y 14109 Puntos
[03:23] Serpiente-Marron Tiempo! La respuesta es -> amadeo <- [03:23] Serpiente-Marron
Tiempo! La respuesta es -> amadeo <-
[03:24] Serpiente-Marron If you think a Q&A is wrong, please call an OP [03:24] Serpiente-Marron
If you think a Q&A is wrong, please call an OP
[03:24] Serpiente-Marron Tri.12742 Medicina-Saludɚytox˿Comocsencalsificanhgenericamentenlasqvitaminasq?o [03:24] Serpiente-Marron
Tri.12742 Medicina-Saludɚytox˿Comocsencalsificanhgenericamentenlasqvitaminasq?o
[03:24] Serpiente-Marron 1 Pista: ************ * ************* Valor pregunta : 11356 Puntos [03:24] Serpiente-Marron
1 Pista: ************ * ************* Valor pregunta : 11356 Puntos
[03:24] Serpiente-Marron 2 Pista: lip********* * ************* 30 segundos y 11356 Puntos [03:24] Serpiente-Marron
2 Pista: lip********* * ************* 30 segundos y 11356 Puntos
[03:24] Serpiente-Marron 3 Pista: lipo*o*u**e* e *i**o*o*u**e* 15 segundos y 11356 Puntos [03:24] Serpiente-Marron
3 Pista: lipo*o*u**e* e *i**o*o*u**e* 15 segundos y 11356 Puntos
[03:24] Serpiente-Marron Tiempo! La respuesta es -> liposolubles��idrosolubles <- [03:24] Serpiente-Marron
Tiempo! La respuesta es -> liposolubles��idrosolubles <-
[03:24] Serpiente-Marron R᮫ing por D́: - Domingo: Gladiadora_del_Caribe 1799967 Lunes: CAP2630 2205895 Martes: Culebra{Naranja 1914185 Miercoles: Culebra{Naranja 1715545 Jueves: Culebra{Naranja 1769462 Viernes: Gladiadora_del_Caribe 1992978 Sᢡdo: Gladiadora_del_Caribe 1324395 [03:24] Serpiente-Marron
R᮫ing por D́: - Domingo: Gladiadora_del_Caribe 1799967 Lunes: CAP2630 2205895 Martes: Culebra{Naranja 1914185 Miercoles: Culebra{Naranja 1715545 Jueves: Culebra{Naranja 1769462 Viernes: Gladiadora_del_Caribe 1992978 Sᢡdo: Gladiadora_del_Caribe 1324395
[03:24] Serpiente-Marron Tri.13023 DeporteɔeLaRaNhA˿GanadorbdelaTourbdetFrancias1953a?a [03:24] Serpiente-Marron
Tri.13023 DeporteɔeLaRaNhA˿GanadorbdelaTourbdetFrancias1953a?a
[03:24] Serpiente-Marron 1 Pista: ******* ***** Valor pregunta : 23212 Puntos [03:24] Serpiente-Marron
1 Pista: ******* ***** Valor pregunta : 23212 Puntos
[03:25] Serpiente-Marron 2 Pista: lou**** ***** 30 segundos y 23212 Puntos [03:25] Serpiente-Marron
2 Pista: lou**** ***** 30 segundos y 23212 Puntos
[03:25] Serpiente-Marron 3 Pista: loui*o* *o*e* 15 segundos y 23212 Puntos [03:25] Serpiente-Marron
3 Pista: loui*o* *o*e* 15 segundos y 23212 Puntos
[03:25] Serpiente-Marron Tiempo! La respuesta es -> louison�obet <- [03:25] Serpiente-Marron
Tiempo! La respuesta es -> louison�obet <-
[03:25] Serpiente-Marron For The Competitive Edge type !pingme [03:25] Serpiente-Marron
For The Competitive Edge type !pingme
[03:25] Serpiente-Marron Tri.13825 CancionesɃocoman˿Deiquientesblawcanciont"Cruzodeinavajas"o?o [03:25] Serpiente-Marron
Tri.13825 CancionesɃocoman˿Deiquientesblawcanciont"Cruzodeinavajas"o?o
[03:25] Serpiente-Marron 1 Pista: ****** Pregunta de BONUS : 25000 Puntos [03:25] Serpiente-Marron
1 Pista: ****** Pregunta de BONUS : 25000 Puntos
[03:25] Culebra{Naranja mecano [03:25] Culebra{Naranja
mecano
[03:25] Serpiente-Marron �emuestra lo que sabes Culebra{Naranja! Has respondido "mecano" correctamente y eso te da: �5000�12 puntos [03:25] Serpiente-Marron
�emuestra lo que sabes Culebra{Naranja! Has respondido "mecano" correctamente y eso te da: �5000�12 puntos
[03:25] Serpiente-Marron Culebra{Naranja has acertado 37 seguidas!! Puntos HOY: 599606, SEMANA: 8868332 y MES: 15386896 [03:25] Serpiente-Marron
Culebra{Naranja has acertado 37 seguidas!! Puntos HOY: 599606, SEMANA: 8868332 y MES: 15386896
[03:25] Serpiente-Marron 37 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:25] Serpiente-Marron
37 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:26] Serpiente-Marron Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [03:26] Serpiente-Marron
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[03:26] Serpiente-Marron Tri.8569 Personajesɑuim˿Enaqueypa�01wnaci󃰱lelkpayasotCharlieyRivelk?l [03:26] Serpiente-Marron
Tri.8569 Personajesɑuim˿Enaqueypa�01wnaci󃰱lelkpayasotCharlieyRivelk?l
[03:26] Serpiente-Marron 1 Pista: ****񪠃 Pregunta de BONUS : 200000 Puntos [03:26] Serpiente-Marron
1 Pista: ****񪠃 Pregunta de BONUS : 200000 Puntos
[03:26] Culebra{Naranja espa�a [03:26] Culebra{Naranja
espa�a
[03:26] Serpiente-Marron �Eso es Culebra{Naranja!! Dijiste: "espa񡢃12 y ello te ha valido: �00000�12 puntos [03:26] Serpiente-Marron
�Eso es Culebra{Naranja!! Dijiste: "espa񡢃12 y ello te ha valido: �00000�12 puntos
[03:26] Serpiente-Marron Culebra{Naranja has acertado 38 seguidas!! Puntos HOY: 799606, SEMANA: 9068332 y MES: 15586896 [03:26] Serpiente-Marron
Culebra{Naranja has acertado 38 seguidas!! Puntos HOY: 799606, SEMANA: 9068332 y MES: 15586896
[03:26] Serpiente-Marron 38 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:26] Serpiente-Marron
38 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:26] Serpiente-Marron R᮫ing MES: - #1: Culebra{Naranja 15386896 #2: Gladiadora_del_Caribe 11737007 #3: siva- 2676459 #4: Fred46 2616141 #5: CAP2632 2481083 #6: CAP2630 2205895 #7: Sirena__ 1241518 #8: Alii 1036251 #9: Cosmo 1009399 #10: MorenoAltoyFibrado 886845 [03:26] Serpiente-Marron
R᮫ing MES: - #1: Culebra{Naranja 15386896 #2: Gladiadora_del_Caribe 11737007 #3: siva- 2676459 #4: Fred46 2616141 #5: CAP2632 2481083 #6: CAP2630 2205895 #7: Sirena__ 1241518 #8: Alii 1036251 #9: Cosmo 1009399 #10: MorenoAltoyFibrado 886845
[03:26] Serpiente-Marron Tri.9677 Miscelaneaɓebosin˿C󭯃01bsenlenllamadalgtoquenparadquenlasnfuerzasndenunadguarnici󮃰1pobcampobsenponganpsobrenlasnarmas?v?v [03:26] Serpiente-Marron
Tri.9677 Miscelaneaɓebosin˿C󭯃01bsenlenllamadalgtoquenparadquenlasnfuerzasndenunadguarnici󮃰1pobcampobsenponganpsobrenlasnarmas?v?v
[03:26] Serpiente-Marron 1 Pista: ******** Valor pregunta : 16978 Puntos [03:26] Serpiente-Marron
1 Pista: ******** Valor pregunta : 16978 Puntos
[03:26] Serpiente-Marron 2 Pista: gen***** 30 segundos y 16978 Puntos [03:26] Serpiente-Marron
2 Pista: gen***** 30 segundos y 16978 Puntos
[03:27] Serpiente-Marron 3 Pista: gene*a*a 15 segundos y 16978 Puntos [03:27] Serpiente-Marron
3 Pista: gene*a*a 15 segundos y 16978 Puntos
[03:27] Serpiente-Marron Tiempo! La respuesta es -> generala <- [03:27] Serpiente-Marron
Tiempo! La respuesta es -> generala <-
[03:27] Serpiente-Marron Please refrain from using Extreme Bad Language [03:27] Serpiente-Marron
Please refrain from using Extreme Bad Language
[03:27] Serpiente-Marron Tri.244 Cienciaɤassler˿Enqqu郰1aa񯃰1msecprodujomlahmayorsexplosi󮃰1qdetectadahhastaheltmomentomenqlahTierra?a?a [03:27] Serpiente-Marron
Tri.244 Cienciaɤassler˿Enqqu郰1aa񯃰1msecprodujomlahmayorsexplosi󮃰1qdetectadahhastaheltmomentomenqlahTierra?a?a
[03:27] Serpiente-Marron 1 Pista: **** Valor pregunta : 22979 Puntos [03:27] Serpiente-Marron
1 Pista: **** Valor pregunta : 22979 Puntos
[03:27] Serpiente-Marron 2 Pista: 184* 30 segundos y 22979 Puntos [03:27] Serpiente-Marron
2 Pista: 184* 30 segundos y 22979 Puntos
[03:28] Serpiente-Marron 3 Pista: 184* 15 segundos y 22979 Puntos [03:28] Serpiente-Marron
3 Pista: 184* 15 segundos y 22979 Puntos
[03:28] Serpiente-Marron Tiempo! La respuesta es -> 1843 <- [03:28] Serpiente-Marron
Tiempo! La respuesta es -> 1843 <-
[03:28] Serpiente-Marron This is #Mexico, I am your host Serpiente-Marron, running Serpiente-Marron [03:28] Serpiente-Marron
This is #Mexico, I am your host Serpiente-Marron, running Serpiente-Marron
[03:28] Serpiente-Marron Tri.19569 CineɌaufer˿ACTORwQUEwADELGAZӃ01w22wKILOSwPARAwRODARw"NAUFRAGOw?w [03:28] Serpiente-Marron
Tri.19569 CineɌaufer˿ACTORwQUEwADELGAZӃ01w22wKILOSwPARAwRODARw"NAUFRAGOw?w
[03:28] Serpiente-Marron 1 Pista: *** ***** Valor pregunta : 12249 Puntos [03:28] Serpiente-Marron
1 Pista: *** ***** Valor pregunta : 12249 Puntos
[03:28] Serpiente-Marron 2 Pista: tom ***** 30 segundos y 12249 Puntos [03:28] Serpiente-Marron
2 Pista: tom ***** 30 segundos y 12249 Puntos
[03:28] Culebra{Naranja tom jones [03:28] Culebra{Naranja
tom jones
[03:28] Serpiente-Marron 3 Pista: tom *a*** 15 segundos y 12249 Puntos [03:28] Serpiente-Marron
3 Pista: tom *a*** 15 segundos y 12249 Puntos
[03:29] Serpiente-Marron Tiempo! La respuesta es -> tom�anks <- [03:29] Serpiente-Marron
Tiempo! La respuesta es -> tom�anks <-
[03:29] Serpiente-Marron This WEEKS Top 11-20: - #11: Fred46 189310 #12: lindisita1 151021 #13: Yobiss 142697 #14: AlitaSs 98904 #15: Fernanda16 94755 #16: NN_vOx_exterminio-fiscal 68804 #17: LeCaTwaLk_z 66815 #18: m-bladee 50000 #19: Chiqktrks_- 43194 #20: MorenoAltoyFibrado 29890 [03:29] Serpiente-Marron
This WEEKS Top 11-20: - #11: Fred46 189310 #12: lindisita1 151021 #13: Yobiss 142697 #14: AlitaSs 98904 #15: Fernanda16 94755 #16: NN_vOx_exterminio-fiscal 68804 #17: LeCaTwaLk_z 66815 #18: m-bladee 50000 #19: Chiqktrks_- 43194 #20: MorenoAltoyFibrado 29890
[03:29] Serpiente-Marron Tri.19528 MiscelaneaɁwelete˿Cabezaulocaunobquiere...h?h [03:29] Serpiente-Marron
Tri.19528 MiscelaneaɁwelete˿Cabezaulocaunobquiere...h?h
[03:29] Serpiente-Marron 1 Pista: **** Valor pregunta : 23396 Puntos [03:29] Serpiente-Marron
1 Pista: **** Valor pregunta : 23396 Puntos
[03:29] Cocodrilo-Naranja ¦ Emitiendo ( elvigilante ) | Lugar ( Puerto Rico ) | Temática ( Musica Variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Pide tu canción comando: .tocame Tema-Artista [03:29] Cocodrilo-Naranja
¦ Emitiendo ( elvigilante ) | Lugar ( Puerto Rico ) | Temática ( Musica Variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Pide tu canción comando: .tocame Tema-Artista
[03:29] Serpiente-Marron 2 Pista: toc* 30 segundos y 23396 Puntos [03:29] Serpiente-Marron
2 Pista: toc* 30 segundos y 23396 Puntos
[03:29] Serpiente-Marron 3 Pista: toca 15 segundos y 23396 Puntos [03:29] Serpiente-Marron
3 Pista: toca 15 segundos y 23396 Puntos
[03:30] Serpiente-Marron Tiempo! La respuesta es -> toca <- [03:30] Serpiente-Marron
Tiempo! La respuesta es -> toca <-
[03:30] Serpiente-Marron Please remember this is a FREE service, Please do not complain [03:30] Serpiente-Marron
Please remember this is a FREE service, Please do not complain
[03:30] Serpiente-Marron Tri.9190 Cancionesɖonk˿Dexquienaesjmonkeyfwrenchr?x [03:30] Serpiente-Marron
Tri.9190 Cancionesɖonk˿Dexquienaesjmonkeyfwrenchr?x
[03:30] Serpiente-Marron 1 Pista: *** ******** Valor pregunta : 23188 Puntos [03:30] Serpiente-Marron
1 Pista: *** ******** Valor pregunta : 23188 Puntos
[03:30] Serpiente-Marron 2 Pista: foo ******** 30 segundos y 23188 Puntos [03:30] Serpiente-Marron
2 Pista: foo ******** 30 segundos y 23188 Puntos
[03:30] Serpiente-Marron 3 Pista: foo *i***e** 15 segundos y 23188 Puntos [03:30] Serpiente-Marron
3 Pista: foo *i***e** 15 segundos y 23188 Puntos
[03:30] Cocodrilo-Naranja ? Radio Luna de Miel | DJ: elvigilante | Tema: Musica Variada | Peticiones: Abiertas ? | Canción: Ha*Ash ? ¿Qué Me Faltó? [03:30] Cocodrilo-Naranja
? Radio Luna de Miel | DJ: elvigilante | Tema: Musica Variada | Peticiones: Abiertas ? | Canción: Ha*Ash ? ¿Qué Me Faltó?
[03:30] Culebra{Naranja .radio [03:30] Culebra{Naranja
.radio
[03:31] Serpiente-Marron Tiempo! La respuesta es -> foo�ighters <- [03:31] Serpiente-Marron
Tiempo! La respuesta es -> foo�ighters <-
[03:31] Serpiente-Marron This MONTHS Top 11-20: - #11: KaZuMa_KiRyU 557750 #12: wilby 339535 #13: Ketzy 308075 #14: kitana_- 244720 #15: NN_vOx_Musulprogres 160581 #16: lindisita1 151021 #17: Yobiss 142697 #18: Abril- 107146 #19: AlitaSs 98904 #20: Fernanda16 94755 [03:31] Serpiente-Marron
This MONTHS Top 11-20: - #11: KaZuMa_KiRyU 557750 #12: wilby 339535 #13: Ketzy 308075 #14: kitana_- 244720 #15: NN_vOx_Musulprogres 160581 #16: lindisita1 151021 #17: Yobiss 142697 #18: Abril- 107146 #19: AlitaSs 98904 #20: Fernanda16 94755
[03:31] Serpiente-Marron Tri.9417 MitologiaɆrigotora˿Diosavn󲤩cavdemlavfertilidadyypmaestravdemlavmagia?n?n [03:31] Serpiente-Marron
Tri.9417 MitologiaɆrigotora˿Diosavn󲤩cavdemlavfertilidadyypmaestravdemlavmagia?n?n
[03:31] Serpiente-Marron 1 Pista: ***** Valor pregunta : 19708 Puntos [03:31] Serpiente-Marron
1 Pista: ***** Valor pregunta : 19708 Puntos
[03:31] Serpiente-Marron 2 Pista: fre** 30 segundos y 19708 Puntos [03:31] Serpiente-Marron
2 Pista: fre** 30 segundos y 19708 Puntos
[03:31] Culebra{Naranja freda [03:31] Culebra{Naranja
freda
[03:31] Serpiente-Marron 3 Pista: fre*a 15 segundos y 19708 Puntos [03:31] Serpiente-Marron
3 Pista: fre*a 15 segundos y 19708 Puntos
[03:31] Culebra{Naranja fresa [03:31] Culebra{Naranja
fresa
[03:31] Serpiente-Marron Tiempo! La respuesta es -> freya <- [03:31] Serpiente-Marron
Tiempo! La respuesta es -> freya <-
[03:32] Serpiente-Marron R᮫ing �ltima SEMANA: #1: Culebra{Naranja 10483560 #2: Gladiadora_del_Caribe 6590569 #3: siva- 4847579 [03:32] Serpiente-Marron
R᮫ing �ltima SEMANA: #1: Culebra{Naranja 10483560 #2: Gladiadora_del_Caribe 6590569 #3: siva- 4847579
[03:32] Serpiente-Marron Tri.2376 LiteraturaɃarPEnTer˿(HarryyPotter)zC󭯃01jsegllamadelvdirectorgdegHogwartse?z [03:32] Serpiente-Marron
Tri.2376 LiteraturaɃarPEnTer˿(HarryyPotter)zC󭯃01jsegllamadelvdirectorgdegHogwartse?z
[03:32] Serpiente-Marron 1 Pista: ***** ********** Valor pregunta : 19271 Puntos [03:32] Serpiente-Marron
1 Pista: ***** ********** Valor pregunta : 19271 Puntos
[03:32] Serpiente-Marron 2 Pista: alb** ********** 30 segundos y 19271 Puntos [03:32] Serpiente-Marron
2 Pista: alb** ********** 30 segundos y 19271 Puntos
[03:32] Serpiente-Marron 3 Pista: albu* *u***e*o*e 15 segundos y 19271 Puntos [03:32] Serpiente-Marron
3 Pista: albu* *u***e*o*e 15 segundos y 19271 Puntos
[03:32] Serpiente-Marron Tiempo! La respuesta es -> albus�umbledore <- [03:32] Serpiente-Marron
Tiempo! La respuesta es -> albus�umbledore <-
[03:33] Serpiente-Marron Top10 Players ( Weekly & Monthly ) are Auto-Voiced [03:33] Serpiente-Marron
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[03:33] Serpiente-Marron Tri.10275 Miscelaneaɓebosin˿C󭯃01tsecllamaneldmodotdecsuicidarsecjapon鳬dquecconsistecenqabrirseceldvientrec(espa񯬩zado)?d?d [03:33] Serpiente-Marron
Tri.10275 Miscelaneaɓebosin˿C󭯃01tsecllamaneldmodotdecsuicidarsecjapon鳬dquecconsistecenqabrirseceldvientrec(espa񯬩zado)?d?d
[03:33] Serpiente-Marron 1 Pista: ********* Valor pregunta : 20259 Puntos [03:33] Serpiente-Marron
1 Pista: ********* Valor pregunta : 20259 Puntos
[03:33] Serpiente-Marron 2 Pista: har****** 30 segundos y 20259 Puntos [03:33] Serpiente-Marron
2 Pista: har****** 30 segundos y 20259 Puntos
[03:33] Serpiente-Marron 3 Pista: hara*ui*i 15 segundos y 20259 Puntos [03:33] Serpiente-Marron
3 Pista: hara*ui*i 15 segundos y 20259 Puntos
[03:33] Culebra{Naranja haraquiri [03:33] Culebra{Naranja
haraquiri
[03:33] Serpiente-Marron �Est᳠que lo tiras Culebra{Naranja!! ߃󭯠supiste que "haraquiri" era la respuesta? Venga, �0259�12 puntos suben a tu marcador [03:33] Serpiente-Marron
�Est᳠que lo tiras Culebra{Naranja!! ߃󭯠supiste que "haraquiri" era la respuesta? Venga, �0259�12 puntos suben a tu marcador
[03:33] Serpiente-Marron Culebra{Naranja has acertado 39 seguidas!! Puntos HOY: 819865, SEMANA: 9088591 y MES: 15607155 [03:33] Serpiente-Marron
Culebra{Naranja has acertado 39 seguidas!! Puntos HOY: 819865, SEMANA: 9088591 y MES: 15607155
[03:33] Serpiente-Marron 39 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:33] Serpiente-Marron
39 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:33] Serpiente-Marron Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [03:33] Serpiente-Marron
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[03:33] Serpiente-Marron Tri.14070 Politicaɓsurfer˿Enuquefpaisusefcelebr󃰱blanIbCumbrefIberoamericanan?b [03:33] Serpiente-Marron
Tri.14070 Politicaɓsurfer˿Enuquefpaisusefcelebr󃰱blanIbCumbrefIberoamericanan?b
[03:33] Serpiente-Marron 1 Pista: ****** Valor pregunta : 19903 Puntos [03:33] Serpiente-Marron
1 Pista: ****** Valor pregunta : 19903 Puntos
[03:34] Serpiente-Marron 2 Pista: mex*** 30 segundos y 19903 Puntos [03:34] Serpiente-Marron
2 Pista: mex*** 30 segundos y 19903 Puntos
[03:34] Culebra{Naranja mexico [03:34] Culebra{Naranja
mexico
[03:34] Serpiente-Marron �Enhorabuena Culebra{Naranja!! Has contestado "mexico" y por ello has ganado �9903�12 puntos [03:34] Serpiente-Marron
�Enhorabuena Culebra{Naranja!! Has contestado "mexico" y por ello has ganado �9903�12 puntos
[03:34] Serpiente-Marron Culebra{Naranja has acertado 40 seguidas!! Puntos HOY: 839768, SEMANA: 9108494 y MES: 15627058 [03:34] Serpiente-Marron
Culebra{Naranja has acertado 40 seguidas!! Puntos HOY: 839768, SEMANA: 9108494 y MES: 15627058
[03:34] Serpiente-Marron Bonus especial de 90000 Puntos para Culebra{Naranja por acertar 40 seguidas!!! [03:34] Serpiente-Marron
Bonus especial de 90000 Puntos para Culebra{Naranja por acertar 40 seguidas!!!
[03:34] Serpiente-Marron 40 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:34] Serpiente-Marron
40 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:34] Serpiente-Marron R᮫ing SEMANA: - #1: Culebra{Naranja 9198494 #2: Gladiadora_del_Caribe 6723585 #3: CAP2630 2205895 #4: Sirena__ 1107842 #5: Alii 1036251 #6: siva- 530841 #7: Cosmo 427307 #8: Ketzy 308075 #9: KaZuMa_KiRyU 230692 #10: kitana_- 213209 [03:34] Serpiente-Marron
R᮫ing SEMANA: - #1: Culebra{Naranja 9198494 #2: Gladiadora_del_Caribe 6723585 #3: CAP2630 2205895 #4: Sirena__ 1107842 #5: Alii 1036251 #6: siva- 530841 #7: Cosmo 427307 #8: Ketzy 308075 #9: KaZuMa_KiRyU 230692 #10: kitana_- 213209
[03:34] Serpiente-Marron Tri.20045 Miscelaneaɴamzarian˿Conqqu郰1icuatroipersonajesnseyencontr󃰱iBudarelwd�01renqqueyseyleyabrieronqlosnojosnarlarmiseriardeylarcondici󮃰1qhumana?i?i [03:34] Serpiente-Marron
Tri.20045 Miscelaneaɴamzarian˿Conqqu郰1icuatroipersonajesnseyencontr󃰱iBudarelwd�01renqqueyseyleyabrieronqlosnojosnarlarmiseriardeylarcondici󮃰1qhumana?i?i
[03:34] Serpiente-Marron 1 Pista: ** ***** ** ******* ** ******* * ** ***** ********** Valor pregunta : 17245 Puntos [03:34] Serpiente-Marron
1 Pista: ** ***** ** ******* ** ******* * ** ***** ********** Valor pregunta : 17245 Puntos
[03:34] Serpiente-Marron 2 Pista: un�**** ** ******* ** ******* * ** ***** ********** 30 segundos y 17245 Puntos [03:34] Serpiente-Marron
2 Pista: un�**** ** ******* ** ******* * ** ***** ********** 30 segundos y 17245 Puntos
[03:34] Serpiente-Marron 3 Pista: un�ie*o u* e**e**o u* *a*a*e* * u* *o**e *e**i*a**e 15 segundos y 17245 Puntos [03:34] Serpiente-Marron
3 Pista: un�ie*o u* e**e**o u* *a*a*e* * u* *o**e *e**i*a**e 15 segundos y 17245 Puntos
[03:35] Serpiente-Marron Tiempo! La respuesta es -> un�iejo�n�nfermo�n�adaver��n�onje�endicante <- [03:35] Serpiente-Marron
Tiempo! La respuesta es -> un�iejo�n�nfermo�n�adaver��n�onje�endicante <-
[03:35] Serpiente-Marron We feature over 50,000 Q&A ! [03:35] Serpiente-Marron
We feature over 50,000 Q&A !
[03:35] Serpiente-Marron Tri.13303 GeografiaɍARdeJAVA˿DEdQUɃ01dESTADOdNORTEAMERICANO,dSITUADOdENdLAdESQUINAdNORDESTEdDEdEE.UU,dESdCAPITALdAUGUSTA?d?d [03:35] Serpiente-Marron
Tri.13303 GeografiaɍARdeJAVA˿DEdQUɃ01dESTADOdNORTEAMERICANO,dSITUADOdENdLAdESQUINAdNORDESTEdDEdEE.UU,dESdCAPITALdAUGUSTA?d?d
[03:35] Serpiente-Marron 1 Pista: ***** Valor pregunta : 5254 Puntos [03:35] Serpiente-Marron
1 Pista: ***** Valor pregunta : 5254 Puntos
[03:35] Serpiente-Marron 2 Pista: mai** 30 segundos y 5254 Puntos [03:35] Serpiente-Marron
2 Pista: mai** 30 segundos y 5254 Puntos
[03:35] Serpiente-Marron 3 Pista: mai*e 15 segundos y 5254 Puntos [03:35] Serpiente-Marron
3 Pista: mai*e 15 segundos y 5254 Puntos
[03:36] Serpiente-Marron Tiempo! La respuesta es -> maine <- [03:36] Serpiente-Marron
Tiempo! La respuesta es -> maine <-
[03:36] Serpiente-Marron Tri.4416 Cotilleo-TVɖivian˿C󭯃01useillamabaglagbotagmascotagdeiUn,ddos,dtres,drespondagotragvez?d?d [03:36] Serpiente-Marron
Tri.4416 Cotilleo-TVɖivian˿C󭯃01useillamabaglagbotagmascotagdeiUn,ddos,dtres,drespondagotragvez?d?d
[03:36] Serpiente-Marron 1 Pista: ******* Valor pregunta : 22046 Puntos [03:36] Serpiente-Marron
1 Pista: ******* Valor pregunta : 22046 Puntos
[03:36] Serpiente-Marron 2 Pista: bot**** 30 segundos y 22046 Puntos [03:36] Serpiente-Marron
2 Pista: bot**** 30 segundos y 22046 Puntos
[03:36] Culebra{Naranja botilde [03:36] Culebra{Naranja
botilde
[03:36] Serpiente-Marron �Suma y sigue Culebra{Naranja!! La respuesta: "botilde" incrementa tu marcador en �2046�12 puntos [03:36] Serpiente-Marron
�Suma y sigue Culebra{Naranja!! La respuesta: "botilde" incrementa tu marcador en �2046�12 puntos
[03:36] Serpiente-Marron Culebra{Naranja has acertado 41 seguidas!! Puntos HOY: 951814, SEMANA: 9220540 y MES: 15739104 [03:36] Serpiente-Marron
Culebra{Naranja has acertado 41 seguidas!! Puntos HOY: 951814, SEMANA: 9220540 y MES: 15739104
[03:36] Serpiente-Marron 41 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:36] Serpiente-Marron
41 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:36] Serpiente-Marron Tri.4163 Geografiaɓebosin˿Cuᬃ01wespelwanteriordnombrehdehMyanmar?c?c [03:36] Serpiente-Marron
Tri.4163 Geografiaɓebosin˿Cuᬃ01wespelwanteriordnombrehdehMyanmar?c?c
[03:36] Serpiente-Marron 1 Pista: ******** Valor pregunta : 12935 Puntos [03:36] Serpiente-Marron
1 Pista: ******** Valor pregunta : 12935 Puntos
[03:36] Serpiente-Marron 2 Pista: bir***** 30 segundos y 12935 Puntos [03:36] Serpiente-Marron
2 Pista: bir***** 30 segundos y 12935 Puntos
[03:37] Serpiente-Marron 3 Pista: bir*a*ia 15 segundos y 12935 Puntos [03:37] Serpiente-Marron
3 Pista: bir*a*ia 15 segundos y 12935 Puntos
[03:37] Serpiente-Marron Tiempo! La respuesta es -> birmania <- [03:37] Serpiente-Marron
Tiempo! La respuesta es -> birmania <-
[03:37] Culebra{Naranja birmania [03:37] Culebra{Naranja
birmania
[03:37] Serpiente-Marron Please remember this is a FREE service, Please do not complain [03:37] Serpiente-Marron
Please remember this is a FREE service, Please do not complain
[03:37] Serpiente-Marron Tri.6882 Economiaɦurillo˿COMOlSElDENOMINAlAlLAlINCAPACIDADlPERMANENTElDELlSISTEMAlTRIBUTARIOlPARAlFINANCIARlLAlDINAMICAlDELlGASTOlPUBLICOl?l [03:37] Serpiente-Marron
Tri.6882 Economiaɦurillo˿COMOlSElDENOMINAlAlLAlINCAPACIDADlPERMANENTElDELlSISTEMAlTRIBUTARIOlPARAlFINANCIARlLAlDINAMICAlDELlGASTOlPUBLICOl?l
[03:37] Serpiente-Marron 1 Pista: ******* *********** Pregunta de BONUS : 25000 Puntos [03:37] Serpiente-Marron
1 Pista: ******* *********** Pregunta de BONUS : 25000 Puntos
[03:37] Serpiente-Marron 2 Pista: def**** *********** 30 segundos y 25000 Puntos [03:37] Serpiente-Marron
2 Pista: def**** *********** 30 segundos y 25000 Puntos
[03:38] Serpiente-Marron 3 Pista: defi*i* e***u**u*a* 15 segundos y 25000 Puntos [03:38] Serpiente-Marron
3 Pista: defi*i* e***u**u*a* 15 segundos y 25000 Puntos
[03:38] Serpiente-Marron Tiempo! La respuesta es -> deficit�structural <- [03:38] Serpiente-Marron
Tiempo! La respuesta es -> deficit�structural <-
[03:38] Serpiente-Marron R᮫ing �ltimo MES: #1: Culebra{Naranja 52886387 #2: Gladiadora_del_Caribe 23128897 #3: Flamenco}Eficiente 15623946 #4: siva- 10800261 #5: Guiarte_Yo 2584013 [03:38] Serpiente-Marron
R᮫ing �ltimo MES: #1: Culebra{Naranja 52886387 #2: Gladiadora_del_Caribe 23128897 #3: Flamenco}Eficiente 15623946 #4: siva- 10800261 #5: Guiarte_Yo 2584013
[03:38] Serpiente-Marron Tri.1311 HistoriaɊAVEA˿6rJUNIOr1907:rDErQUErPAISrACTUAL,rDECIDErPORrENTONCErELrGOBIERNOrBRITANICOrDErNOrDEJARrDErSERrSIEMPRErUNArCOLONIAr?r [03:38] Serpiente-Marron
Tri.1311 HistoriaɊAVEA˿6rJUNIOr1907:rDErQUErPAISrACTUAL,rDECIDErPORrENTONCErELrGOBIERNOrBRITANICOrDErNOrDEJARrDErSERrSIEMPRErUNArCOLONIAr?r
[03:38] Serpiente-Marron 1 Pista: ***** Valor pregunta : 13182 Puntos [03:38] Serpiente-Marron
1 Pista: ***** Valor pregunta : 13182 Puntos
[03:38] Serpiente-Marron 2 Pista: IND** 30 segundos y 13182 Puntos [03:38] Serpiente-Marron
2 Pista: IND** 30 segundos y 13182 Puntos
[03:38] Culebra{Naranja india [03:38] Culebra{Naranja
india
[03:38] Serpiente-Marron �Eso es Culebra{Naranja!! Dijiste: "india" y ello te ha valido: �3182�12 puntos [03:38] Serpiente-Marron
�Eso es Culebra{Naranja!! Dijiste: "india" y ello te ha valido: �3182�12 puntos
[03:38] Serpiente-Marron Culebra{Naranja has acertado 42 seguidas!! Puntos HOY: 964996, SEMANA: 9233722 y MES: 15752286 [03:38] Serpiente-Marron
Culebra{Naranja has acertado 42 seguidas!! Puntos HOY: 964996, SEMANA: 9233722 y MES: 15752286
[03:38] Serpiente-Marron 42 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:38] Serpiente-Marron
42 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:39] Serpiente-Marron If you think a Q&A is wrong, please call an OP [03:39] Serpiente-Marron
If you think a Q&A is wrong, please call an OP
[03:39] Serpiente-Marron Tri.20410 Informaticaɍorigutsu˿COMANDOSlUNIX:lVISUALlEDITORl?l [03:39] Serpiente-Marron
Tri.20410 Informaticaɍorigutsu˿COMANDOSlUNIX:lVISUALlEDITORl?l
[03:39] Serpiente-Marron 1 Pista: ** Valor pregunta : 17896 Puntos [03:39] Serpiente-Marron
1 Pista: ** Valor pregunta : 17896 Puntos
[03:39] Serpiente-Marron 2 Pista: vi 30 segundos y 17896 Puntos [03:39] Serpiente-Marron
2 Pista: vi 30 segundos y 17896 Puntos
[03:39] Culebra{Naranja vi [03:39] Culebra{Naranja
vi
[03:39] Serpiente-Marron �Bingo!! Culebra{Naranja dio la respuesta: "vi" en �8.359 segundos e incrementa sus ganancias con �7896�12 puntos [03:39] Serpiente-Marron
�Bingo!! Culebra{Naranja dio la respuesta: "vi" en �8.359 segundos e incrementa sus ganancias con �7896�12 puntos
[03:39] Serpiente-Marron Culebra{Naranja has acertado 43 seguidas!! Puntos HOY: 982892, SEMANA: 9251618 y MES: 15770182 [03:39] Serpiente-Marron
Culebra{Naranja has acertado 43 seguidas!! Puntos HOY: 982892, SEMANA: 9251618 y MES: 15770182
[03:39] Serpiente-Marron 43 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:39] Serpiente-Marron
43 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:39] Serpiente-Marron R᮫ing por D́: - Domingo: Gladiadora_del_Caribe 1799967 Lunes: CAP2630 2205895 Martes: Culebra{Naranja 1914185 Miercoles: Culebra{Naranja 1715545 Jueves: Culebra{Naranja 1769462 Viernes: Gladiadora_del_Caribe 1992978 Sᢡdo: Gladiadora_del_Caribe 1324395 [03:39] Serpiente-Marron
R᮫ing por D́: - Domingo: Gladiadora_del_Caribe 1799967 Lunes: CAP2630 2205895 Martes: Culebra{Naranja 1914185 Miercoles: Culebra{Naranja 1715545 Jueves: Culebra{Naranja 1769462 Viernes: Gladiadora_del_Caribe 1992978 Sᢡdo: Gladiadora_del_Caribe 1324395
[03:39] Serpiente-Marron Tri.3865 Fisica-QuimicaɃort˿Comoqsefllamanplasdpatillasddefunptransistord(ordenpalfab鴩co)t?t [03:39] Serpiente-Marron
Tri.3865 Fisica-QuimicaɃort˿Comoqsefllamanplasdpatillasddefunptransistord(ordenpalfab鴩co)t?t
[03:39] Serpiente-Marron 1 Pista: **** ******** * ****** Valor pregunta : 13950 Puntos [03:39] Serpiente-Marron
1 Pista: **** ******** * ****** Valor pregunta : 13950 Puntos
[03:39] Serpiente-Marron 2 Pista: bas* ******** * ****** 30 segundos y 13950 Puntos [03:39] Serpiente-Marron
2 Pista: bas* ******** * ****** 30 segundos y 13950 Puntos
[03:40] Serpiente-Marron 3 Pista: base *o*e**o* * e*i*o* 15 segundos y 13950 Puntos [03:40] Serpiente-Marron
3 Pista: base *o*e**o* * e*i*o* 15 segundos y 13950 Puntos
[03:40] Serpiente-Marron Tiempo! La respuesta es -> base�olector��misor <- [03:40] Serpiente-Marron
Tiempo! La respuesta es -> base�olector��misor <-
[03:40] Serpiente-Marron For The Competitive Edge type !pingme [03:40] Serpiente-Marron
For The Competitive Edge type !pingme
[03:40] Serpiente-Marron Tri.15535 MitologiaɁlkaid˿ENpQUEpCONVIRTIOpJUNOpApCALISTOpPORpCAUSApDEpSUpBELLEZA?p?p [03:40] Serpiente-Marron
Tri.15535 MitologiaɁlkaid˿ENpQUEpCONVIRTIOpJUNOpApCALISTOpPORpCAUSApDEpSUpBELLEZA?p?p
[03:40] Serpiente-Marron 1 Pista: *** Valor pregunta : 20471 Puntos [03:40] Serpiente-Marron
1 Pista: *** Valor pregunta : 20471 Puntos
[03:40] Serpiente-Marron 2 Pista: osa 30 segundos y 20471 Puntos [03:40] Serpiente-Marron
2 Pista: osa 30 segundos y 20471 Puntos
[03:40] Culebra{Naranja osa [03:40] Culebra{Naranja
osa
[03:40] Serpiente-Marron �Increible!! Culebra{Naranja contest󺠃04"osa" en �8.203 segundos, y ha ganado �0471�12 puntos [03:40] Serpiente-Marron
�Increible!! Culebra{Naranja contest󺠃04"osa" en �8.203 segundos, y ha ganado �0471�12 puntos
[03:40] Serpiente-Marron Culebra{Naranja has acertado 44 seguidas!! Puntos HOY: 1003363, SEMANA: 9272089 y MES: 15790653 [03:40] Serpiente-Marron
Culebra{Naranja has acertado 44 seguidas!! Puntos HOY: 1003363, SEMANA: 9272089 y MES: 15790653
[03:40] Serpiente-Marron 44 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:40] Serpiente-Marron
44 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:40] Serpiente-Marron Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [03:40] Serpiente-Marron
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[03:40] Serpiente-Marron Tri.5145 Cancionesɓawn˿Demquemgrupobesqlahcanciono"yesterdayeoncemmore"y?y [03:40] Serpiente-Marron
Tri.5145 Cancionesɓawn˿Demquemgrupobesqlahcanciono"yesterdayeoncemmore"y?y
[03:40] Serpiente-Marron 1 Pista: ********** Valor pregunta : 13264 Puntos [03:40] Serpiente-Marron
1 Pista: ********** Valor pregunta : 13264 Puntos
[03:41] Serpiente-Marron 2 Pista: car******* 30 segundos y 13264 Puntos [03:41] Serpiente-Marron
2 Pista: car******* 30 segundos y 13264 Puntos
[03:41] Serpiente-Marron 3 Pista: car*e**e** 15 segundos y 13264 Puntos [03:41] Serpiente-Marron
3 Pista: car*e**e** 15 segundos y 13264 Puntos
[03:41] Culebra{Naranja carpenters [03:41] Culebra{Naranja
carpenters
[03:41] Serpiente-Marron �Est᳠que lo tiras Culebra{Naranja!! ߃󭯠supiste que "carpenters" era la respuesta? Venga, �3264�12 puntos suben a tu marcador [03:41] Serpiente-Marron
�Est᳠que lo tiras Culebra{Naranja!! ߃󭯠supiste que "carpenters" era la respuesta? Venga, �3264�12 puntos suben a tu marcador
[03:41] Serpiente-Marron Culebra{Naranja has acertado 45 seguidas!! Puntos HOY: 1016627, SEMANA: 9285353 y MES: 15803917 [03:41] Serpiente-Marron
Culebra{Naranja has acertado 45 seguidas!! Puntos HOY: 1016627, SEMANA: 9285353 y MES: 15803917
[03:41] Serpiente-Marron 45 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:41] Serpiente-Marron
45 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:41] Serpiente-Marron R᮫ing MES: - #1: Culebra{Naranja 15790653 #2: Gladiadora_del_Caribe 11737007 #3: siva- 2676459 #4: Fred46 2616141 #5: CAP2632 2481083 #6: CAP2630 2205895 #7: Sirena__ 1241518 #8: Alii 1036251 #9: Cosmo 1009399 #10: MorenoAltoyFibrado 886845 [03:41] Serpiente-Marron
R᮫ing MES: - #1: Culebra{Naranja 15790653 #2: Gladiadora_del_Caribe 11737007 #3: siva- 2676459 #4: Fred46 2616141 #5: CAP2632 2481083 #6: CAP2630 2205895 #7: Sirena__ 1241518 #8: Alii 1036251 #9: Cosmo 1009399 #10: MorenoAltoyFibrado 886845
[03:41] Serpiente-Marron Tri.7088 LiteraturaɔeLaRaNhA˿Autorideo"laccruzpardiente"p?p [03:41] Serpiente-Marron
Tri.7088 LiteraturaɔeLaRaNhA˿Autorideo"laccruzpardiente"p?p
[03:41] Serpiente-Marron 1 Pista: ***** ******** Valor pregunta : 22197 Puntos [03:41] Serpiente-Marron
1 Pista: ***** ******** Valor pregunta : 22197 Puntos
[03:42] Serpiente-Marron 2 Pista: dia** ******** 30 segundos y 22197 Puntos [03:42] Serpiente-Marron
2 Pista: dia** ******** 30 segundos y 22197 Puntos
[03:42] Serpiente-Marron 3 Pista: dia*a *a*a**o* 15 segundos y 22197 Puntos [03:42] Serpiente-Marron
3 Pista: dia*a *a*a**o* 15 segundos y 22197 Puntos
[03:42] Serpiente-Marron Tiempo! La respuesta es -> diana�abaldon <- [03:42] Serpiente-Marron
Tiempo! La respuesta es -> diana�abaldon <-
[03:42] Serpiente-Marron Please refrain from using Extreme Bad Language [03:42] Serpiente-Marron
Please refrain from using Extreme Bad Language
[03:42] Serpiente-Marron Tri.4767 ArteɁigua˿Artewyntecnicahdelmgrabadojenacobrew?y [03:42] Serpiente-Marron
Tri.4767 ArteɁigua˿Artewyntecnicahdelmgrabadojenacobrew?y
[03:42] Serpiente-Marron 1 Pista: *********** Valor pregunta : 12841 Puntos [03:42] Serpiente-Marron
1 Pista: *********** Valor pregunta : 12841 Puntos
[03:42] Serpiente-Marron 2 Pista: cal******** 30 segundos y 12841 Puntos [03:42] Serpiente-Marron
2 Pista: cal******** 30 segundos y 12841 Puntos
[03:43] Serpiente-Marron 3 Pista: cal*o**a*ia 15 segundos y 12841 Puntos [03:43] Serpiente-Marron
3 Pista: cal*o**a*ia 15 segundos y 12841 Puntos
[03:43] Serpiente-Marron Tiempo! La respuesta es -> calcografia <- [03:43] Serpiente-Marron
Tiempo! La respuesta es -> calcografia <-
[03:43] Serpiente-Marron This is #Mexico, I am your host Serpiente-Marron, running Serpiente-Marron [03:43] Serpiente-Marron
This is #Mexico, I am your host Serpiente-Marron, running Serpiente-Marron
[03:43] Serpiente-Marron Tri.6801 Literaturaɉcia˿CualvesaelvtituloodellabnovelabenvlabquelselinspiroolabserielinfantilvMarcoo?y [03:43] Serpiente-Marron
Tri.6801 Literaturaɉcia˿CualvesaelvtituloodellabnovelabenvlabquelselinspiroolabserielinfantilvMarcoo?y
[03:43] Serpiente-Marron 1 Pista: ** *** ******** * *** ***** Valor pregunta : 23019 Puntos [03:43] Serpiente-Marron
1 Pista: ** *** ******** * *** ***** Valor pregunta : 23019 Puntos
[03:43] Serpiente-Marron 2 Pista: de�** ******** * *** ***** 30 segundos y 23019 Puntos [03:43] Serpiente-Marron
2 Pista: de�** ******** * *** ***** 30 segundos y 23019 Puntos
[03:44] Serpiente-Marron 3 Pista: de�o* a*e*i*o* a *o* a**e* 15 segundos y 23019 Puntos [03:44] Serpiente-Marron
3 Pista: de�o* a*e*i*o* a *o* a**e* 15 segundos y 23019 Puntos
[03:44] Cocodrilo-Naranja ¦ Emitiendo ( elvigilante ) | Lugar ( Puerto Rico ) | Temática ( Musica Variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Pide tu canción comando: .tocame Tema-Artista [03:44] Cocodrilo-Naranja
¦ Emitiendo ( elvigilante ) | Lugar ( Puerto Rico ) | Temática ( Musica Variada ) | Escúchanos por: https://www.radiolunademiel.com - La radio que endulza tus sentidos | Pide tu canción comando: .tocame Tema-Artista
[03:44] Serpiente-Marron Tiempo! La respuesta es -> de�os�peninos��os�ndes <- [03:44] Serpiente-Marron
Tiempo! La respuesta es -> de�os�peninos��os�ndes <-
[03:44] Serpiente-Marron This WEEKS Top 11-20: - #11: Fred46 189310 #12: lindisita1 151021 #13: Yobiss 142697 #14: AlitaSs 98904 #15: Fernanda16 94755 #16: NN_vOx_exterminio-fiscal 68804 #17: LeCaTwaLk_z 66815 #18: m-bladee 50000 #19: Chiqktrks_- 43194 #20: MorenoAltoyFibrado 29890 [03:44] Serpiente-Marron
This WEEKS Top 11-20: - #11: Fred46 189310 #12: lindisita1 151021 #13: Yobiss 142697 #14: AlitaSs 98904 #15: Fernanda16 94755 #16: NN_vOx_exterminio-fiscal 68804 #17: LeCaTwaLk_z 66815 #18: m-bladee 50000 #19: Chiqktrks_- 43194 #20: MorenoAltoyFibrado 29890
[03:44] Serpiente-Marron Tri.3169 MitologiaɁttica˿Atqu郰1tregi󮃰1kdeloPeloponesowdiownombrewArcas,thijowdewZeus?t?t [03:44] Serpiente-Marron
Tri.3169 MitologiaɁttica˿Atqu郰1tregi󮃰1kdeloPeloponesowdiownombrewArcas,thijowdewZeus?t?t
[03:44] Serpiente-Marron 1 Pista: ******* Valor pregunta : 16712 Puntos [03:44] Serpiente-Marron
1 Pista: ******* Valor pregunta : 16712 Puntos
[03:44] Serpiente-Marron 2 Pista: arc**** 30 segundos y 16712 Puntos [03:44] Serpiente-Marron
2 Pista: arc**** 30 segundos y 16712 Puntos
[03:45] Serpiente-Marron 3 Pista: arca*ia 15 segundos y 16712 Puntos [03:45] Serpiente-Marron
3 Pista: arca*ia 15 segundos y 16712 Puntos
[03:45] Serpiente-Marron Tiempo! La respuesta es -> arcadia <- [03:45] Serpiente-Marron
Tiempo! La respuesta es -> arcadia <-
[03:45] Serpiente-Marron Please remember this is a FREE service, Please do not complain [03:45] Serpiente-Marron
Please remember this is a FREE service, Please do not complain
[03:45] Serpiente-Marron Tri.6696 Deporteɴjmm.comˍotociclismo:fCampe󮃰1pdelomundom2004fdep250fc.c.f?f [03:45] Serpiente-Marron
Tri.6696 Deporteɴjmm.comˍotociclismo:fCampe󮃰1pdelomundom2004fdep250fc.c.f?f
[03:45] Serpiente-Marron 1 Pista: **** ******* Valor pregunta : 18708 Puntos [03:45] Serpiente-Marron
1 Pista: **** ******* Valor pregunta : 18708 Puntos
[03:45] Serpiente-Marron 2 Pista: dan* ******* 30 segundos y 18708 Puntos [03:45] Serpiente-Marron
2 Pista: dan* ******* 30 segundos y 18708 Puntos
[03:46] Serpiente-Marron 3 Pista: dani *e**o*a 15 segundos y 18708 Puntos [03:46] Serpiente-Marron
3 Pista: dani *e**o*a 15 segundos y 18708 Puntos
[03:46] Serpiente-Marron Tiempo! La respuesta es -> dani�edrosa <- [03:46] Serpiente-Marron
Tiempo! La respuesta es -> dani�edrosa <-
[03:46] Serpiente-Marron This MONTHS Top 11-20: - #11: KaZuMa_KiRyU 557750 #12: wilby 339535 #13: Ketzy 308075 #14: kitana_- 244720 #15: NN_vOx_Musulprogres 160581 #16: lindisita1 151021 #17: Yobiss 142697 #18: Abril- 107146 #19: AlitaSs 98904 #20: Fernanda16 94755 [03:46] Serpiente-Marron
This MONTHS Top 11-20: - #11: KaZuMa_KiRyU 557750 #12: wilby 339535 #13: Ketzy 308075 #14: kitana_- 244720 #15: NN_vOx_Musulprogres 160581 #16: lindisita1 151021 #17: Yobiss 142697 #18: Abril- 107146 #19: AlitaSs 98904 #20: Fernanda16 94755
[03:46] Serpiente-Marron Tri.3397 Gastronomiaɓort˿DEmQUEmDONDEmSONmTIPICOSmLASmCASADIELLESm?m [03:46] Serpiente-Marron
Tri.3397 Gastronomiaɓort˿DEmQUEmDONDEmSONmTIPICOSmLASmCASADIELLESm?m
[03:46] Serpiente-Marron 1 Pista: ******** Valor pregunta : 12532 Puntos [03:46] Serpiente-Marron
1 Pista: ******** Valor pregunta : 12532 Puntos
[03:46] Serpiente-Marron 2 Pista: ast***** 30 segundos y 12532 Puntos [03:46] Serpiente-Marron
2 Pista: ast***** 30 segundos y 12532 Puntos
[03:46] Serpiente-Marron 3 Pista: astu*ia* 15 segundos y 12532 Puntos [03:46] Serpiente-Marron
3 Pista: astu*ia* 15 segundos y 12532 Puntos
[03:46] Culebra{Naranja asturias [03:46] Culebra{Naranja
asturias
[03:46] Serpiente-Marron �e nota que sabes mucho de esto Culebra{Naranja! Tu respuesta "asturias" es correcta y ganas �2532�12 puntos [03:46] Serpiente-Marron
�e nota que sabes mucho de esto Culebra{Naranja! Tu respuesta "asturias" es correcta y ganas �2532�12 puntos
[03:46] Serpiente-Marron Culebra{Naranja has acertado 46 seguidas!! Puntos HOY: 1029159, SEMANA: 9297885 y MES: 15816449 [03:46] Serpiente-Marron
Culebra{Naranja has acertado 46 seguidas!! Puntos HOY: 1029159, SEMANA: 9297885 y MES: 15816449
[03:46] Serpiente-Marron 46 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!? [03:46] Serpiente-Marron
46 in a Row !!! I Think that Culebra{Naranja is HOGGING the Quiz !!! Is Everybody Asleep!?
[03:47] Serpiente-Marron R᮫ing �ltima SEMANA: #1: Culebra{Naranja 10483560 #2: Gladiadora_del_Caribe 6590569 #3: siva- 4847579 [03:47] Serpiente-Marron
R᮫ing �ltima SEMANA: #1: Culebra{Naranja 10483560 #2: Gladiadora_del_Caribe 6590569 #3: siva- 4847579
[03:47] Serpiente-Marron Tri.8609 Idiomasɦlipp_er˿FRANCES--->ESPAяL:esprith?y [03:47] Serpiente-Marron
Tri.8609 Idiomasɦlipp_er˿FRANCES--->ESPAяL:esprith?y
[03:47] Serpiente-Marron 1 Pista: ******** Valor pregunta : 8372 Puntos [03:47] Serpiente-Marron
1 Pista: ******** Valor pregunta : 8372 Puntos
[03:47] Serpiente-Marron 2 Pista: esp***** 30 segundos y 8372 Puntos [03:47] Serpiente-Marron
2 Pista: esp***** 30 segundos y 8372 Puntos
[03:47] Serpiente-Marron 3 Pista: espi*i*u 15 segundos y 8372 Puntos [03:47] Serpiente-Marron
3 Pista: espi*i*u 15 segundos y 8372 Puntos
[03:47] Serpiente-Marron Tiempo! La respuesta es -> espiritu <- [03:47] Serpiente-Marron
Tiempo! La respuesta es -> espiritu <-
[03:48] Serpiente-Marron Top10 Players ( Weekly & Monthly ) are Auto-Voiced [03:48] Serpiente-Marron
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[03:48] Serpiente-Marron Tri.19578 Cineɘti˿DIRECTORxDEx"COMOxDIOS"x?x [03:48] Serpiente-Marron
Tri.19578 Cineɘti˿DIRECTORxDEx"COMOxDIOS"x?x
[03:48] Serpiente-Marron 1 Pista: *** ******* Pregunta de BONUS : 50000 Puntos [03:48] Serpiente-Marron
1 Pista: *** ******* Pregunta de BONUS : 50000 Puntos
[03:48] Serpiente-Marron 2 Pista: tom ******* 30 segundos y 50000 Puntos [03:48] Serpiente-Marron
2 Pista: tom ******* 30 segundos y 50000 Puntos
[03:48] Serpiente-Marron 3 Pista: tom **a**a* 15 segundos y 50000 Puntos [03:48] Serpiente-Marron
3 Pista: tom **a**a* 15 segundos y 50000 Puntos
[03:48] Serpiente-Marron Tiempo! La respuesta es -> tom�hadyac <- [03:48] Serpiente-Marron
Tiempo! La respuesta es -> tom�hadyac <-
[03:48] Serpiente-Marron Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [03:48] Serpiente-Marron
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[03:48] Serpiente-Marron Tri.12598 Politicaɭ˿C󭯃01rsefllamakellpresidentefdefUcraniak(A񯃰1r2003)?f?f [03:48] Serpiente-Marron
Tri.12598 Politicaɭ˿C󭯃01rsefllamakellpresidentefdefUcraniak(A񯃰1r2003)?f?f
[03:48] Serpiente-Marron 1 Pista: ****** ****** Valor pregunta : 21682 Puntos [03:48] Serpiente-Marron
1 Pista: ****** ****** Valor pregunta : 21682 Puntos
[03:49] Serpiente-Marron 2 Pista: leo*** ****** 30 segundos y 21682 Puntos [03:49] Serpiente-Marron
2 Pista: leo*** ****** 30 segundos y 21682 Puntos
[03:49] Serpiente-Marron 3 Pista: leo*i* *u***a 15 segundos y 21682 Puntos [03:49] Serpiente-Marron
3 Pista: leo*i* *u***a 15 segundos y 21682 Puntos
[03:49] Serpiente-Marron Tiempo! La respuesta es -> leonid�uchma <- [03:49] Serpiente-Marron
Tiempo! La respuesta es -> leonid�uchma <-
[03:49] Serpiente-Marron R᮫ing SEMANA: - #1: Culebra{Naranja 9297885 #2: Gladiadora_del_Caribe 6723585 #3: CAP2630 2205895 #4: Sirena__ 1107842 #5: Alii 1036251 #6: siva- 530841 #7: Cosmo 427307 #8: Ketzy 308075 #9: KaZuMa_KiRyU 230692 #10: kitana_- 213209 [03:49] Serpiente-Marron
R᮫ing SEMANA: - #1: Culebra{Naranja 9297885 #2: Gladiadora_del_Caribe 6723585 #3: CAP2630 2205895 #4: Sirena__ 1107842 #5: Alii 1036251 #6: siva- 530841 #7: Cosmo 427307 #8: Ketzy 308075 #9: KaZuMa_KiRyU 230692 #10: kitana_- 213209
[03:49] Serpiente-Marron Tri.7017 Economiaɦurilllo˿COMOzSEzDENOMINAzELzCONJUNTOzDEzPASIVOSzFINANCIEROSzQUEzLAzADMINISTRACIONzTIENEzCONzELzSECTORzPRIVADOz?z [03:49] Serpiente-Marron
Tri.7017 Economiaɦurilllo˿COMOzSEzDENOMINAzELzCONJUNTOzDEzPASIVOSzFINANCIEROSzQUEzLAzADMINISTRACIONzTIENEzCONzELzSECTORzPRIVADOz?z
[03:49] Serpiente-Marron 1 Pista: ***** ******* Valor pregunta : 22745 Puntos [03:49] Serpiente-Marron
1 Pista: ***** ******* Valor pregunta : 22745 Puntos
[03:50] Serpiente-Marron 2 Pista: deu** ******* 30 segundos y 22745 Puntos [03:50] Serpiente-Marron
2 Pista: deu** ******* 30 segundos y 22745 Puntos
[03:50] Serpiente-Marron 3 Pista: deu*a *u**i*a 15 segundos y 22745 Puntos [03:50] Serpiente-Marron
3 Pista: deu*a *u**i*a 15 segundos y 22745 Puntos
[03:50] Serpiente-Marron Tiempo! La respuesta es -> deuda�ublica <- [03:50] Serpiente-Marron
Tiempo! La respuesta es -> deuda�ublica <-
[03:50] Serpiente-Marron We feature over 50,000 Q&A ! [03:50] Serpiente-Marron
We feature over 50,000 Q&A !
[03:50] Serpiente-Marron Tri.1898 Eros-SexɃarPEnTer˿C󭯃01xseellam󃰱glarversi󮃰1zpornoxdeePesadillarenzElmkStreetm(ingl鳩g?g [03:50] Serpiente-Marron
Tri.1898 Eros-SexɃarPEnTer˿C󭯃01xseellam󃰱glarversi󮃰1zpornoxdeePesadillarenzElmkStreetm(ingl鳩g?g
[03:50] Serpiente-Marron 1 Pista: * *** ***** ** *** ****** Pregunta de BONUS : 50000 Puntos [03:50] Serpiente-Marron
1 Pista: * *** ***** ** *** ****** Pregunta de BONUS : 50000 Puntos
[03:51] Serpiente-Marron 2 Pista: a�** ***** ** *** ****** 30 segundos y 50000 Puntos [03:51] Serpiente-Marron
2 Pista: a�** ***** ** *** ****** 30 segundos y 50000 Puntos
[03:51] Serpiente-Marron 3 Pista: a�e* **ea* o* e** ***ee* 15 segundos y 50000 Puntos [03:51] Serpiente-Marron
3 Pista: a�e* **ea* o* e** ***ee* 15 segundos y 50000 Puntos
[03:51] Serpiente-Marron Tiempo! La respuesta es -> a�et�ream�n�lm�treet <- [03:51] Serpiente-Marron
Tiempo! La respuesta es -> a�et�ream�n�lm�treet <-
[03:51] Serpiente-Marron Tri.17662 Deporteɢruji˿BALONrDErOROr2002r?r [03:51] Serpiente-Marron
Tri.17662 Deporteɢruji˿BALONrDErOROr2002r?r
[03:51] Serpiente-Marron 1 Pista: ******* Valor pregunta : 23985 Puntos [03:51] Serpiente-Marron
1 Pista: ******* Valor pregunta : 23985 Puntos
[03:52] Serpiente-Marron 2 Pista: ron**** 30 segundos y 23985 Puntos [03:52] Serpiente-Marron
2 Pista: ron**** 30 segundos y 23985 Puntos
[03:52] Serpiente-Marron 3 Pista: rona**o 15 segundos y 23985 Puntos [03:52] Serpiente-Marron
3 Pista: rona**o 15 segundos y 23985 Puntos
[03:52] Serpiente-Marron Tiempo! La respuesta es -> ronaldo <- [03:52] Serpiente-Marron
Tiempo! La respuesta es -> ronaldo <-
[03:52] Serpiente-Marron Tri.9450 Informaticaɍorigutsu˿COMANDOSmUNIX:mCOMPRUEBAmELmSISTEMAmDEmARCHIVOSm?m [03:52] Serpiente-Marron
Tri.9450 Informaticaɍorigutsu˿COMANDOSmUNIX:mCOMPRUEBAmELmSISTEMAmDEmARCHIVOSm?m
[03:52] Serpiente-Marron 1 Pista: **** Valor pregunta : 16940 Puntos [03:52] Serpiente-Marron
1 Pista: **** Valor pregunta : 16940 Puntos
[03:52] Serpiente-Marron 2 Pista: fsc* 30 segundos y 16940 Puntos [03:52] Serpiente-Marron
2 Pista: fsc* 30 segundos y 16940 Puntos
[03:53] Serpiente-Marron 3 Pista: fsc* 15 segundos y 16940 Puntos [03:53] Serpiente-Marron
3 Pista: fsc* 15 segundos y 16940 Puntos
[03:53] Serpiente-Marron Tiempo! La respuesta es -> fsck <- [03:53] Serpiente-Marron
Tiempo! La respuesta es -> fsck <-
[03:53] Serpiente-Marron Please remember this is a FREE service, Please do not complain [03:53] Serpiente-Marron
Please remember this is a FREE service, Please do not complain
[03:53] Serpiente-Marron Tri.10315 Historiaɳubmarin˿GraciaseaqqueobatallaqlogrotSaladinotconquistarjJerusal鮿p?p [03:53] Serpiente-Marron
Tri.10315 Historiaɳubmarin˿GraciaseaqqueobatallaqlogrotSaladinotconquistarjJerusal鮿p?p
[03:53] Serpiente-Marron 1 Pista: ****** Valor pregunta : 16883 Puntos [03:53] Serpiente-Marron
1 Pista: ****** Valor pregunta : 16883 Puntos
[03:53] Serpiente-Marron 2 Pista: hat*** 30 segundos y 16883 Puntos [03:53] Serpiente-Marron
2 Pista: hat*** 30 segundos y 16883 Puntos
[03:54] Serpiente-Marron 3 Pista: hat*i* 15 segundos y 16883 Puntos [03:54] Serpiente-Marron
3 Pista: hat*i* 15 segundos y 16883 Puntos
[03:54] Serpiente-Marron Tiempo! La respuesta es -> hattin <- [03:54] Serpiente-Marron
Tiempo! La respuesta es -> hattin <-
[03:54] Serpiente-Marron R᮫ing �ltimo MES: #1: Culebra{Naranja 52886387 #2: Gladiadora_del_Caribe 23128897 #3: Flamenco}Eficiente 15623946 #4: siva- 10800261 #5: Guiarte_Yo 2584013 [03:54] Serpiente-Marron
R᮫ing �ltimo MES: #1: Culebra{Naranja 52886387 #2: Gladiadora_del_Caribe 23128897 #3: Flamenco}Eficiente 15623946 #4: siva- 10800261 #5: Guiarte_Yo 2584013
[03:54] Serpiente-Marron Tri.19215 MusicaɃort˿C󭯃01useollamanllosucomponentesudelvgrupouC󭰬icesu?x [03:54] Serpiente-Marron
Tri.19215 MusicaɃort˿C󭯃01useollamanllosucomponentesudelvgrupouC󭰬icesu?x
[03:54] Serpiente-Marron 1 Pista: *** ******** * ***** ******** Valor pregunta : 16311 Puntos [03:54] Serpiente-Marron
1 Pista: *** ******** * ***** ******** Valor pregunta : 16311 Puntos
[03:54] Serpiente-Marron 2 Pista: teo ******** * ***** ******** 30 segundos y 16311 Puntos [03:54] Serpiente-Marron
2 Pista: teo ******** * ***** ******** 30 segundos y 16311 Puntos
[03:55] Serpiente-Marron 3 Pista: teo *a**a**a * *a*ia *o**o*i* 15 segundos y 16311 Puntos [03:55] Serpiente-Marron
3 Pista: teo *a**a**a * *a*ia *o**o*i* 15 segundos y 16311 Puntos
[03:55] Serpiente-Marron Tiempo! La respuesta es -> teo�ardalda��aria�onsonis <- [03:55] Serpiente-Marron
Tiempo! La respuesta es -> teo�ardalda��aria�onsonis <-
[03:55] Serpiente-Marron If you think a Q&A is wrong, please call an OP [03:55] Serpiente-Marron
If you think a Q&A is wrong, please call an OP
[03:55] Serpiente-Marron Tri.18770 Cotilleo-TVɴjmm.com˿ElnprimerdapellidozdexDianapdexGalesqera...e?e [03:55] Serpiente-Marron
Tri.18770 Cotilleo-TVɴjmm.com˿ElnprimerdapellidozdexDianapdexGalesqera...e?e
[03:55] Serpiente-Marron 1 Pista: ******* Valor pregunta : 5603 Puntos [03:55] Serpiente-Marron
1 Pista: ******* Valor pregunta : 5603 Puntos
[03:55] Serpiente-Marron 2 Pista: spe**** 30 segundos y 5603 Puntos [03:55] Serpiente-Marron
2 Pista: spe**** 30 segundos y 5603 Puntos
[03:55] Serpiente-Marron 3 Pista: spe**e* 15 segundos y 5603 Puntos [03:55] Serpiente-Marron
3 Pista: spe**e* 15 segundos y 5603 Puntos
[03:56] Serpiente-Marron Tiempo! La respuesta es -> spencer <- [03:56] Serpiente-Marron
Tiempo! La respuesta es -> spencer <-
[03:56] Serpiente-Marron R᮫ing por D́: - Domingo: Gladiadora_del_Caribe 1799967 Lunes: CAP2630 2205895 Martes: Culebra{Naranja 1914185 Miercoles: Culebra{Naranja 1715545 Jueves: Culebra{Naranja 1769462 Viernes: Gladiadora_del_Caribe 1992978 Sᢡdo: Gladiadora_del_Caribe 1324395 [03:56] Serpiente-Marron
R᮫ing por D́: - Domingo: Gladiadora_del_Caribe 1799967 Lunes: CAP2630 2205895 Martes: Culebra{Naranja 1914185 Miercoles: Culebra{Naranja 1715545 Jueves: Culebra{Naranja 1769462 Viernes: Gladiadora_del_Caribe 1992978 Sᢡdo: Gladiadora_del_Caribe 1324395
[03:56] Serpiente-Marron Tri.20419 Biologiaɓcarface˿Comonsedllamanyaslosjpelosjsensorialesjrigidosjquedexistenyenyelwrostrondedmuchosjmamiferosj?v [03:56] Serpiente-Marron
Tri.20419 Biologiaɓcarface˿Comonsedllamanyaslosjpelosjsensorialesjrigidosjquedexistenyenyelwrostrondedmuchosjmamiferosj?v
[03:56] Serpiente-Marron 1 Pista: ******** Valor pregunta : 21906 Puntos [03:56] Serpiente-Marron
1 Pista: ******** Valor pregunta : 21906 Puntos
[03:56] Serpiente-Marron 2 Pista: vib***** 30 segundos y 21906 Puntos [03:56] Serpiente-Marron
2 Pista: vib***** 30 segundos y 21906 Puntos
[03:56] Serpiente-Marron 3 Pista: vib*i*a* 15 segundos y 21906 Puntos [03:56] Serpiente-Marron
3 Pista: vib*i*a* 15 segundos y 21906 Puntos
[03:57] Serpiente-Marron Tiempo! La respuesta es -> vibrisas <- [03:57] Serpiente-Marron
Tiempo! La respuesta es -> vibrisas <-
[03:57] Serpiente-Marron For The Competitive Edge type !pingme [03:57] Serpiente-Marron
For The Competitive Edge type !pingme
[03:57] Serpiente-Marron Tri.6822 Miscelaneaɐsico666ˌaxociosidadbesplaxmadre...d?d [03:57] Serpiente-Marron
Tri.6822 Miscelaneaɐsico666ˌaxociosidadbesplaxmadre...d?d
[03:57] Serpiente-Marron 1 Pista: ** *** **** ***** Valor pregunta : 7461 Puntos [03:57] Serpiente-Marron
1 Pista: ** *** **** ***** Valor pregunta : 7461 Puntos
[03:57] Serpiente-Marron 2 Pista: de�** **** ***** 30 segundos y 7461 Puntos [03:57] Serpiente-Marron
2 Pista: de�** **** ***** 30 segundos y 7461 Puntos
[03:57] Serpiente-Marron 3 Pista: de�*a *i*a *a**e 15 segundos y 7461 Puntos [03:57] Serpiente-Marron
3 Pista: de�*a *i*a *a**e 15 segundos y 7461 Puntos
[03:58] Serpiente-Marron Tiempo! La respuesta es -> de�na�ida�adre <- [03:58] Serpiente-Marron
Tiempo! La respuesta es -> de�na�ida�adre <-
[03:58] Serpiente-Marron Trivial AUTO Parado. Para reiniciar el Trivial escriba !jugar [03:58] Serpiente-Marron
Trivial AUTO Parado. Para reiniciar el Trivial escriba !jugar
| Compartir en: