Historia de #mexico 14/02/2026 17:15 19 visitas

Hour Alias Mensaje Mensaje
[17:15] Cocodrilo\Suave "Jugar" [17:15] Cocodrilo\Suave
"Jugar"
[17:16] Oso{Naranja Ligar! [17:16] Oso{Naranja
Ligar!
[17:16] Cocodrilo\Suave cómo está? [17:16] Cocodrilo\Suave
cómo está?
[17:16] Oso{Naranja Muy bien, y tu que tal? [17:16] Oso{Naranja
Muy bien, y tu que tal?
[17:16] Cocodrilo\Suave aquí con la virosis [17:16] Cocodrilo\Suave
aquí con la virosis
[17:17] Oso{Naranja bueno, a cuidarse y a ponerle ganas [17:17] Oso{Naranja
bueno, a cuidarse y a ponerle ganas
[17:17] Cocodrilo\Suave si tiene que cumplirse el ciclo [17:17] Cocodrilo\Suave
si tiene que cumplirse el ciclo
[17:18] Oso{Naranja esta sala esta que dá pena [17:18] Oso{Naranja
esta sala esta que dá pena
[17:18] Oso{Naranja ya nadie viene por aqui [17:18] Oso{Naranja
ya nadie viene por aqui
[17:18] Oso{Naranja yo vengo a cambiarle las flores   XD [17:18] Oso{Naranja
yo vengo a cambiarle las flores   XD
[17:18] Cocodrilo\Suave ahorita llegan, como son horas laborables [17:18] Cocodrilo\Suave
ahorita llegan, como son horas laborables
[17:18] Oso{Naranja noo [17:18] Oso{Naranja
noo
[17:18] Oso{Naranja no viene nadie [17:18] Oso{Naranja
no viene nadie
[17:19] Oso{Naranja yo entro mañana tarde y noche [17:19] Oso{Naranja
yo entro mañana tarde y noche
[17:19] Oso{Naranja y no hay nadie [17:19] Oso{Naranja
y no hay nadie
[17:19] Cocodrilo\Suave yo  en ls momentos  descupados [17:19] Cocodrilo\Suave
yo  en ls momentos  descupados
[17:19] Cocodrilo\Suave más que todo a jugar [17:19] Cocodrilo\Suave
más que todo a jugar
[17:19] Oso{Naranja quieres jugar? [17:19] Oso{Naranja
quieres jugar?
[17:19] Oso{Naranja !jugar [17:19] Oso{Naranja
!jugar
[17:19] Libelula{Paciente EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!! [17:19] Libelula{Paciente
EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!!
[17:19] Oso{Naranja ahí lo tienes [17:19] Oso{Naranja
ahí lo tienes
[17:20] Libelula{Paciente R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: Cocodrilo\Suave 7226244 [17:20] Libelula{Paciente
R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: Cocodrilo\Suave 7226244
[17:20] Libelula{Paciente Tri.10549 CienciaɐEDROC˿ELrPUNTOrEXACTOrDONDErSErLOCALIZArUNrTERREMOTOrSErLLAMArFOCOrOr?r?r [17:20] Libelula{Paciente
Tri.10549 CienciaɐEDROC˿ELrPUNTOrEXACTOrDONDErSErLOCALIZArUNrTERREMOTOrSErLLAMArFOCOrOr?r?r
[17:20] Libelula{Paciente 1 Pista: ********** Valor pregunta : 5449 Puntos [17:20] Libelula{Paciente
1 Pista: ********** Valor pregunta : 5449 Puntos
[17:20] Cocodrilo\Suave si con eso quemo el tiempo y salgo del aburrimiento [17:20] Cocodrilo\Suave
si con eso quemo el tiempo y salgo del aburrimiento
[17:20] Libelula{Paciente 2 Pista: hip******* 30 segundos y 5449 Puntos [17:20] Libelula{Paciente
2 Pista: hip******* 30 segundos y 5449 Puntos
[17:20] Libelula{Paciente 3 Pista: hipo*e***o 15 segundos y 5449 Puntos [17:20] Libelula{Paciente
3 Pista: hipo*e***o 15 segundos y 5449 Puntos
[17:20] Libelula{Paciente �Bien Cocodrilo\Suave!! Tu respuesta: "hipocentro" es correcta y ganas �449�12 puntos [17:20] Libelula{Paciente
�Bien Cocodrilo\Suave!! Tu respuesta: "hipocentro" es correcta y ganas �449�12 puntos
[17:20] Libelula{Paciente ACTION awards Cocodrilo\Suave with a +v for having over 15000 points [17:20] Libelula{Paciente
ACTION awards Cocodrilo\Suave with a +v for having over 15000 points
[17:20] Libelula{Paciente Cocodrilo\Suave has acertado 1 seguidas!! Puntos HOY: 939563, SEMANA: 7782524 y MES: 15008768 [17:20] Libelula{Paciente
Cocodrilo\Suave has acertado 1 seguidas!! Puntos HOY: 939563, SEMANA: 7782524 y MES: 15008768
[17:20] Cocodrilo\Suave hipocentro [17:20] Cocodrilo\Suave
hipocentro
[17:20] Libelula{Paciente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [17:20] Libelula{Paciente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[17:20] Libelula{Paciente Tri.7737 MitologiaɍARdeJAVA˿AuQUɃ01uMITOLOǴuPERTENECENuLOSuDIOSESuTHOTuYuPTAH?u?u [17:20] Libelula{Paciente
Tri.7737 MitologiaɍARdeJAVA˿AuQUɃ01uMITOLOǴuPERTENECENuLOSuDIOSESuTHOTuYuPTAH?u?u
[17:20] Libelula{Paciente 1 Pista: ******* Valor pregunta : 5118 Puntos [17:20] Libelula{Paciente
1 Pista: ******* Valor pregunta : 5118 Puntos
[17:21] Libelula{Paciente 2 Pista: egi**** 30 segundos y 5118 Puntos [17:21] Libelula{Paciente
2 Pista: egi**** 30 segundos y 5118 Puntos
[17:21] Cocodrilo\Suave griega [17:21] Cocodrilo\Suave
griega
[17:21] Oso{Naranja egipto [17:21] Oso{Naranja
egipto
[17:21] Libelula{Paciente �Cocodrilo\Suave acert󡡠La respuesta era: "egipcia" y contest󠥮 �1.235 segundos. Se lleva: �118�12 puntos [17:21] Libelula{Paciente
�Cocodrilo\Suave acert󡡠La respuesta era: "egipcia" y contest󠥮 �1.235 segundos. Se lleva: �118�12 puntos
[17:21] Libelula{Paciente ACTION awards Cocodrilo\Suave with a +v for having over 15000 points [17:21] Libelula{Paciente
ACTION awards Cocodrilo\Suave with a +v for having over 15000 points
[17:21] Libelula{Paciente Cocodrilo\Suave has acertado 2 seguidas!! Puntos HOY: 944681, SEMANA: 7787642 y MES: 15013886 [17:21] Libelula{Paciente
Cocodrilo\Suave has acertado 2 seguidas!! Puntos HOY: 944681, SEMANA: 7787642 y MES: 15013886
[17:21] Oso{Naranja egipcio [17:21] Oso{Naranja
egipcio
[17:21] Cocodrilo\Suave egipcia [17:21] Cocodrilo\Suave
egipcia
[17:21] Libelula{Paciente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [17:21] Libelula{Paciente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[17:21] Libelula{Paciente Tri.2298 Geografiaɣarlovigo˿Cualdesfeldprimerwestado,bporwordennalfabetico,bdelEstadosfUnidos?b?b [17:21] Libelula{Paciente
Tri.2298 Geografiaɣarlovigo˿Cualdesfeldprimerwestado,bporwordennalfabetico,bdelEstadosfUnidos?b?b
[17:21] Libelula{Paciente 1 Pista: ******* Valor pregunta : 21224 Puntos [17:21] Libelula{Paciente
1 Pista: ******* Valor pregunta : 21224 Puntos
[17:21] Oso{Naranja alabama [17:21] Oso{Naranja
alabama
[17:21] Libelula{Paciente �Suma y sigue Oso{Naranja!! La respuesta: "alabama" incrementa tu marcador en �1224�12 puntos [17:21] Libelula{Paciente
�Suma y sigue Oso{Naranja!! La respuesta: "alabama" incrementa tu marcador en �1224�12 puntos
[17:21] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:21] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:21] Libelula{Paciente Oso{Naranja has acertado 1 seguidas!! Puntos HOY: 39997, SEMANA: 39997 y MES: 39997 [17:21] Libelula{Paciente
Oso{Naranja has acertado 1 seguidas!! Puntos HOY: 39997, SEMANA: 39997 y MES: 39997
[17:21] Libelula{Paciente R᮫ing SEMANA: - #1: Cocodrilo\Suave 7787642 #2: {FoSFoRiTa} 5002753 #3: Karen 3690094 #4: Alii 1994438 #5: Danielitto 1424982 #6: Ketzy 1150014 #7: NN_vOx-14_Lagrimas-Progres 981673 #8: Cobaya{Letal 734344 #9: Grillo}Respetable 473023 #10: Unheimlich 343574 [17:21] Libelula{Paciente
R᮫ing SEMANA: - #1: Cocodrilo\Suave 7787642 #2: {FoSFoRiTa} 5002753 #3: Karen 3690094 #4: Alii 1994438 #5: Danielitto 1424982 #6: Ketzy 1150014 #7: NN_vOx-14_Lagrimas-Progres 981673 #8: Cobaya{Letal 734344 #9: Grillo}Respetable 473023 #10: Unheimlich 343574
[17:21] Libelula{Paciente Tri.11085 MusicaɁda˿DEtQUɃ01tNACIONALIDADtEStELtGRUPOt"U2"?t?t [17:21] Libelula{Paciente
Tri.11085 MusicaɁda˿DEtQUɃ01tNACIONALIDADtEStELtGRUPOt"U2"?t?t
[17:21] Libelula{Paciente 1 Pista: ********* Pregunta de BONUS : 200000 Puntos [17:21] Libelula{Paciente
1 Pista: ********* Pregunta de BONUS : 200000 Puntos
[17:21] Libelula{Paciente �emuestra lo que sabes Oso{Naranja! Has respondido "irlandesa" correctamente y eso te da: �00000�12 puntos [17:21] Libelula{Paciente
�emuestra lo que sabes Oso{Naranja! Has respondido "irlandesa" correctamente y eso te da: �00000�12 puntos
[17:21] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:21] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:21] Libelula{Paciente Oso{Naranja has acertado 2 seguidas!! Puntos HOY: 239997, SEMANA: 239997 y MES: 239997 [17:21] Libelula{Paciente
Oso{Naranja has acertado 2 seguidas!! Puntos HOY: 239997, SEMANA: 239997 y MES: 239997
[17:21] Oso{Naranja irlandesa [17:21] Oso{Naranja
irlandesa
[17:21] Oso{Naranja ajá [17:21] Oso{Naranja
ajá
[17:21] Libelula{Paciente We feature over 50,000 Q&A ! [17:21] Libelula{Paciente
We feature over 50,000 Q&A !
[17:21] Libelula{Paciente Tri.13392 Cineɫotopoulo˿Enzqu郰1vpel�laadeljgenialjWoodyoAllenzsalewMeryljStreepm?v [17:21] Libelula{Paciente
Tri.13392 Cineɫotopoulo˿Enzqu郰1vpel�laadeljgenialjWoodyoAllenzsalewMeryljStreepm?v
[17:21] Libelula{Paciente 1 Pista: ********* Valor pregunta : 6534 Puntos [17:21] Libelula{Paciente
1 Pista: ********* Valor pregunta : 6534 Puntos
[17:21] Cocodrilo\Suave irlandesa [17:21] Cocodrilo\Suave
irlandesa
[17:22] Oso{Naranja ni idea [17:22] Oso{Naranja
ni idea
[17:22] Libelula{Paciente 2 Pista: man****** 30 segundos y 6534 Puntos [17:22] Libelula{Paciente
2 Pista: man****** 30 segundos y 6534 Puntos
[17:22] Oso{Naranja pistas [17:22] Oso{Naranja
pistas
[17:22] Libelula{Paciente �Muy bien Oso{Naranja!! Acertaste "manhattan" en tan s󬯠�0.328 segundos y por eso has ganado: �534�12 puntos [17:22] Libelula{Paciente
�Muy bien Oso{Naranja!! Acertaste "manhattan" en tan s󬯠�0.328 segundos y por eso has ganado: �534�12 puntos
[17:22] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:22] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:22] Libelula{Paciente Oso{Naranja has acertado 3 seguidas!! Puntos HOY: 246531, SEMANA: 246531 y MES: 246531 [17:22] Libelula{Paciente
Oso{Naranja has acertado 3 seguidas!! Puntos HOY: 246531, SEMANA: 246531 y MES: 246531
[17:22] Oso{Naranja manhattan [17:22] Oso{Naranja
manhattan
[17:22] Libelula{Paciente Tri.15123 Miscelaneaɓebosin˿(Religi󮩃󭯃01wsehllamarlarreligiosarqueha�nvnowharprofesado?t?t [17:22] Libelula{Paciente
Tri.15123 Miscelaneaɓebosin˿(Religi󮩃󭯃01wsehllamarlarreligiosarqueha�nvnowharprofesado?t?t
[17:22] Libelula{Paciente 1 Pista: ******* Valor pregunta : 7553 Puntos [17:22] Libelula{Paciente
1 Pista: ******* Valor pregunta : 7553 Puntos
[17:22] Oso{Naranja novicia [17:22] Oso{Naranja
novicia
[17:22] Libelula{Paciente �Enhorabuena Oso{Naranja!! Has contestado "novicia" y por ello has ganado �553�12 puntos [17:22] Libelula{Paciente
�Enhorabuena Oso{Naranja!! Has contestado "novicia" y por ello has ganado �553�12 puntos
[17:22] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:22] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:22] Libelula{Paciente Oso{Naranja has acertado 4 seguidas!! Puntos HOY: 254084, SEMANA: 254084 y MES: 254084 [17:22] Libelula{Paciente
Oso{Naranja has acertado 4 seguidas!! Puntos HOY: 254084, SEMANA: 254084 y MES: 254084
[17:22] Oso{Naranja la novivia voladora [17:22] Oso{Naranja
la novivia voladora
[17:22] Libelula{Paciente Tri.7280 Fisica-QuimicaɁlkaid˿ENuQUEuFENOMENOuLUMINOSOuCONSISTEuELuARCOuIRIS?u?u [17:22] Libelula{Paciente
Tri.7280 Fisica-QuimicaɁlkaid˿ENuQUEuFENOMENOuLUMINOSOuCONSISTEuELuARCOuIRIS?u?u
[17:22] Libelula{Paciente 1 Pista: ********** ** ** *** Valor pregunta : 18956 Puntos [17:22] Libelula{Paciente
1 Pista: ********** ** ** *** Valor pregunta : 18956 Puntos
[17:23] Libelula{Paciente 2 Pista: dis******* ** ** *** 30 segundos y 18956 Puntos [17:23] Libelula{Paciente
2 Pista: dis******* ** ** *** 30 segundos y 18956 Puntos
[17:23] Libelula{Paciente 3 Pista: dis*e**io* *e *a *u* 15 segundos y 18956 Puntos [17:23] Libelula{Paciente
3 Pista: dis*e**io* *e *a *u* 15 segundos y 18956 Puntos
[17:23] Oso{Naranja dificil [17:23] Oso{Naranja
dificil
[17:23] Libelula{Paciente Tiempo! La respuesta es -> dispersion�e�a�uz <- [17:23] Libelula{Paciente
Tiempo! La respuesta es -> dispersion�e�a�uz <-
[17:23] Libelula{Paciente Please remember this is a FREE service, Please do not complain [17:23] Libelula{Paciente
Please remember this is a FREE service, Please do not complain
[17:23] Libelula{Paciente Tri.18849 Idiomasɴjmm.com˄eqfranc鳃01radingl鳺e"Fraise"e?e [17:23] Libelula{Paciente
Tri.18849 Idiomasɴjmm.com˄eqfranc鳃01radingl鳺e"Fraise"e?e
[17:23] Libelula{Paciente 1 Pista: ********** Valor pregunta : 19515 Puntos [17:23] Libelula{Paciente
1 Pista: ********** Valor pregunta : 19515 Puntos
[17:23] Libelula{Paciente 2 Pista: str******* 30 segundos y 19515 Puntos [17:23] Libelula{Paciente
2 Pista: str******* 30 segundos y 19515 Puntos
[17:24] Oso{Naranja stronger [17:24] Oso{Naranja
stronger
[17:24] Libelula{Paciente 3 Pista: stra**e*** 15 segundos y 19515 Puntos [17:24] Libelula{Paciente
3 Pista: stra**e*** 15 segundos y 19515 Puntos
[17:24] Oso{Naranja strange [17:24] Oso{Naranja
strange
[17:24] Libelula{Paciente Tiempo! La respuesta es -> strawberry <- [17:24] Libelula{Paciente
Tiempo! La respuesta es -> strawberry <-
[17:24] Cocodrilo\Suave phrase [17:24] Cocodrilo\Suave
phrase
[17:24] Libelula{Paciente R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: {FoSFoRiTa} 30927547 #4: Grillo}Respetable 16843241 #5: Karen 14172663 [17:24] Libelula{Paciente
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: {FoSFoRiTa} 30927547 #4: Grillo}Respetable 16843241 #5: Karen 14172663
[17:24] Libelula{Paciente Tri.8263 Gastronomiaɓheva˿Condqueifrutowseifabricawlawginebraw?p [17:24] Libelula{Paciente
Tri.8263 Gastronomiaɓheva˿Condqueifrutowseifabricawlawginebraw?p
[17:24] Libelula{Paciente 1 Pista: ****** Valor pregunta : 11255 Puntos [17:24] Libelula{Paciente
1 Pista: ****** Valor pregunta : 11255 Puntos
[17:24] Libelula{Paciente 2 Pista: ene*** 30 segundos y 11255 Puntos [17:24] Libelula{Paciente
2 Pista: ene*** 30 segundos y 11255 Puntos
[17:24] Cocodrilo\Suave bayas [17:24] Cocodrilo\Suave
bayas
[17:24] Cocodrilo\Suave enebro [17:24] Cocodrilo\Suave
enebro
[17:24] Libelula{Paciente �Est᳠que lo tiras Cocodrilo\Suave!! ߃󭯠supiste que "enebro" era la respuesta? Venga, �1255�12 puntos suben a tu marcador [17:24] Libelula{Paciente
�Est᳠que lo tiras Cocodrilo\Suave!! ߃󭯠supiste que "enebro" era la respuesta? Venga, �1255�12 puntos suben a tu marcador
[17:24] Libelula{Paciente ACTION awards Cocodrilo\Suave with a +v for having over 15000 points [17:24] Libelula{Paciente
ACTION awards Cocodrilo\Suave with a +v for having over 15000 points
[17:24] Libelula{Paciente Cocodrilo\Suave has acertado 1 seguidas!! Puntos HOY: 955936, SEMANA: 7798897 y MES: 15025141 [17:24] Libelula{Paciente
Cocodrilo\Suave has acertado 1 seguidas!! Puntos HOY: 955936, SEMANA: 7798897 y MES: 15025141
[17:25] Libelula{Paciente If you think a Q&A is wrong, please call an OP [17:25] Libelula{Paciente
If you think a Q&A is wrong, please call an OP
[17:25] Libelula{Paciente Tri.17219 Eros-Sexɴjmm.com˿Elxperineobfemeninobtambi鮃01jsemllamaa"front󮢃01zporquemessdonde...:))))z?z [17:25] Libelula{Paciente
Tri.17219 Eros-Sexɴjmm.com˿Elxperineobfemeninobtambi鮃01jsemllamaa"front󮢃01zporquemessdonde...:))))z?z
[17:25] Libelula{Paciente 1 Pista: ******* *** ******* Pregunta de BONUS : 100000 Puntos [17:25] Libelula{Paciente
1 Pista: ******* *** ******* Pregunta de BONUS : 100000 Puntos
[17:25] Libelula{Paciente 2 Pista: reb**** *** ******* 30 segundos y 100000 Puntos [17:25] Libelula{Paciente
2 Pista: reb**** *** ******* 30 segundos y 100000 Puntos
[17:25] Libelula{Paciente 3 Pista: rebo*a* *a* *e*o*a* 15 segundos y 100000 Puntos [17:25] Libelula{Paciente
3 Pista: rebo*a* *a* *e*o*a* 15 segundos y 100000 Puntos
[17:25] Libelula{Paciente Tiempo! La respuesta es -> rebotan�as�elotas <- [17:25] Libelula{Paciente
Tiempo! La respuesta es -> rebotan�as�elotas <-
[17:26] Libelula{Paciente R᮫ing por D́: - Domingo: Ketzy 1150014 Lunes: Karen 1245745 Martes: {FoSFoRiTa} 388010 Miercoles: Cocodrilo\Suave 2638625 Jueves: Karen 824895 Viernes: Cocodrilo\Suave 2430737 Sᢡdo: welcome3 3286708 [17:26] Libelula{Paciente
R᮫ing por D́: - Domingo: Ketzy 1150014 Lunes: Karen 1245745 Martes: {FoSFoRiTa} 388010 Miercoles: Cocodrilo\Suave 2638625 Jueves: Karen 824895 Viernes: Cocodrilo\Suave 2430737 Sᢡdo: welcome3 3286708
[17:26] Libelula{Paciente Tri.20476 Geografiaɳorgo˿CU�rESrLArMAYORrCIUDAD,rNOrCAPITALrDErPROVINCIA,rDErGALICIA?r?r [17:26] Libelula{Paciente
Tri.20476 Geografiaɳorgo˿CU�rESrLArMAYORrCIUDAD,rNOrCAPITALrDErPROVINCIA,rDErGALICIA?r?r
[17:26] Libelula{Paciente 1 Pista: **** Valor pregunta : 23449 Puntos [17:26] Libelula{Paciente
1 Pista: **** Valor pregunta : 23449 Puntos
[17:26] Oso{Naranja vigo [17:26] Oso{Naranja
vigo
[17:26] Libelula{Paciente �Increible!! Oso{Naranja contest󺠃04"vigo" en �.531 segundos, y ha ganado �3449�12 puntos [17:26] Libelula{Paciente
�Increible!! Oso{Naranja contest󺠃04"vigo" en �.531 segundos, y ha ganado �3449�12 puntos
[17:26] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:26] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:26] Libelula{Paciente Oso{Naranja has acertado 1 seguidas!! Puntos HOY: 277533, SEMANA: 277533 y MES: 277533 [17:26] Libelula{Paciente
Oso{Naranja has acertado 1 seguidas!! Puntos HOY: 277533, SEMANA: 277533 y MES: 277533
[17:26] Cocodrilo\Suave vigo [17:26] Cocodrilo\Suave
vigo
[17:26] Libelula{Paciente For The Competitive Edge type !pingme [17:26] Libelula{Paciente
For The Competitive Edge type !pingme
[17:26] Libelula{Paciente Tri.7362 Cotilleo-TVɚytox˿ComolsejllamacelamayorrenemigoldejMazingerrZq?q [17:26] Libelula{Paciente
Tri.7362 Cotilleo-TVɚytox˿ComolsejllamacelamayorrenemigoldejMazingerrZq?q
[17:26] Libelula{Paciente 1 Pista: ****** ******** Valor pregunta : 13865 Puntos [17:26] Libelula{Paciente
1 Pista: ****** ******** Valor pregunta : 13865 Puntos
[17:26] Libelula{Paciente 2 Pista: doc*** ******** 30 segundos y 13865 Puntos [17:26] Libelula{Paciente
2 Pista: doc*** ******** 30 segundos y 13865 Puntos
[17:26] Libelula{Paciente 3 Pista: doc*o* i**ie**o 15 segundos y 13865 Puntos [17:26] Libelula{Paciente
3 Pista: doc*o* i**ie**o 15 segundos y 13865 Puntos
[17:26] Cocodrilo\Suave doctor  hell [17:26] Cocodrilo\Suave
doctor  hell
[17:27] Libelula{Paciente Tiempo! La respuesta es -> doctor�nfierno <- [17:27] Libelula{Paciente
Tiempo! La respuesta es -> doctor�nfierno <-
[17:27] Cocodrilo\Suave doctor infierno [17:27] Cocodrilo\Suave
doctor infierno
[17:27] Libelula{Paciente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [17:27] Libelula{Paciente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[17:27] Libelula{Paciente Tri.12047 Miscelaneaɓebosin˿(Religi󮩃󭯃01ksetllamapelzDiostindiokquetestlapoctavapencarnaci󮃰1odetVisn�?q?q [17:27] Libelula{Paciente
Tri.12047 Miscelaneaɓebosin˿(Religi󮩃󭯃01ksetllamapelzDiostindiokquetestlapoctavapencarnaci󮃰1odetVisn�?q?q
[17:27] Libelula{Paciente 1 Pista: ******* Valor pregunta : 22783 Puntos [17:27] Libelula{Paciente
1 Pista: ******* Valor pregunta : 22783 Puntos
[17:27] Oso{Naranja casi [17:27] Oso{Naranja
casi
[17:27] Libelula{Paciente 2 Pista: kri**** 30 segundos y 22783 Puntos [17:27] Libelula{Paciente
2 Pista: kri**** 30 segundos y 22783 Puntos
[17:27] Oso{Naranja krisna [17:27] Oso{Naranja
krisna
[17:27] Cocodrilo\Suave krishna [17:27] Cocodrilo\Suave
krishna
[17:27] Libelula{Paciente �Eso es Cocodrilo\Suave!! Dijiste: "krishna" y ello te ha valido: �2783�12 puntos [17:27] Libelula{Paciente
�Eso es Cocodrilo\Suave!! Dijiste: "krishna" y ello te ha valido: �2783�12 puntos
[17:27] Libelula{Paciente ACTION awards Cocodrilo\Suave with a +v for having over 15000 points [17:27] Libelula{Paciente
ACTION awards Cocodrilo\Suave with a +v for having over 15000 points
[17:27] Libelula{Paciente Cocodrilo\Suave has acertado 1 seguidas!! Puntos HOY: 978719, SEMANA: 7821680 y MES: 15047924 [17:27] Libelula{Paciente
Cocodrilo\Suave has acertado 1 seguidas!! Puntos HOY: 978719, SEMANA: 7821680 y MES: 15047924
[17:27] Oso{Naranja krisnna [17:27] Oso{Naranja
krisnna
[17:27] Libelula{Paciente R᮫ing MES: - #1: welcome3 21243832 #2: Cocodrilo\Suave 15025141 #3: Danielitto 10886756 #4: Karen 9086159 #5: {FoSFoRiTa} 7343057 #6: Alii 5900389 #7: Grillo}Respetable 4138250 #8: Ketzy 1150014 #9: NN_vOx-14_Lagrimas-Progres 981673 #10: NN_vOx_Bukelizacion-YA 839312 [17:27] Libelula{Paciente
R᮫ing MES: - #1: welcome3 21243832 #2: Cocodrilo\Suave 15025141 #3: Danielitto 10886756 #4: Karen 9086159 #5: {FoSFoRiTa} 7343057 #6: Alii 5900389 #7: Grillo}Respetable 4138250 #8: Ketzy 1150014 #9: NN_vOx-14_Lagrimas-Progres 981673 #10: NN_vOx_Bukelizacion-YA 839312
[17:27] Libelula{Paciente Tri.5867 InformaticaɈighlander˿IRC:yCualqeszelqsignificadoedegCTCP?y?y [17:27] Libelula{Paciente
Tri.5867 InformaticaɈighlander˿IRC:yCualqeszelqsignificadoedegCTCP?y?y
[17:27] Libelula{Paciente 1 Pista: ****** ** ****** ******** Valor pregunta : 14188 Puntos [17:27] Libelula{Paciente
1 Pista: ****** ** ****** ******** Valor pregunta : 14188 Puntos
[17:28] Libelula{Paciente 2 Pista: cli*** ** ****** ******** 30 segundos y 14188 Puntos [17:28] Libelula{Paciente
2 Pista: cli*** ** ****** ******** 30 segundos y 14188 Puntos
[17:28] Cocodrilo\Suave consejo tecnico contaduria [17:28] Cocodrilo\Suave
consejo tecnico contaduria
[17:28] Libelula{Paciente 3 Pista: clie** *o **ie** **o*o*o* 15 segundos y 14188 Puntos [17:28] Libelula{Paciente
3 Pista: clie** *o **ie** **o*o*o* 15 segundos y 14188 Puntos
[17:28] Libelula{Paciente Tiempo! La respuesta es -> client�o�lient�rotocol <- [17:28] Libelula{Paciente
Tiempo! La respuesta es -> client�o�lient�rotocol <-
[17:28] Libelula{Paciente Please refrain from using Extreme Bad Language [17:28] Libelula{Paciente
Please refrain from using Extreme Bad Language
[17:28] Libelula{Paciente Tri.12711 Biologiaɳtephenwo˿Aqqu郰1qfamiliavdeeplantascperteneceeelvjacintoo?q?q [17:28] Libelula{Paciente
Tri.12711 Biologiaɳtephenwo˿Aqqu郰1qfamiliavdeeplantascperteneceeelvjacintoo?q?q
[17:28] Libelula{Paciente 1 Pista: ********* Valor pregunta : 7016 Puntos [17:28] Libelula{Paciente
1 Pista: ********* Valor pregunta : 7016 Puntos
[17:29] Oso{Naranja pista [17:29] Oso{Naranja
pista
[17:29] Libelula{Paciente 2 Pista: lil****** 30 segundos y 7016 Puntos [17:29] Libelula{Paciente
2 Pista: lil****** 30 segundos y 7016 Puntos
[17:29] Oso{Naranja lilaceas [17:29] Oso{Naranja
lilaceas
[17:29] Cocodrilo\Suave aspargaceae [17:29] Cocodrilo\Suave
aspargaceae
[17:29] Libelula{Paciente 3 Pista: lilia*ea* 15 segundos y 7016 Puntos [17:29] Libelula{Paciente
3 Pista: lilia*ea* 15 segundos y 7016 Puntos
[17:29] Cocodrilo\Suave aspargaceas [17:29] Cocodrilo\Suave
aspargaceas
[17:29] Oso{Naranja liliaceas [17:29] Oso{Naranja
liliaceas
[17:29] Libelula{Paciente �Suma y sigue Oso{Naranja!! La respuesta: "liliaceas" incrementa tu marcador en �016�12 puntos [17:29] Libelula{Paciente
�Suma y sigue Oso{Naranja!! La respuesta: "liliaceas" incrementa tu marcador en �016�12 puntos
[17:29] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:29] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:29] Libelula{Paciente Oso{Naranja has acertado 1 seguidas!! Puntos HOY: 284549, SEMANA: 284549 y MES: 284549 [17:29] Libelula{Paciente
Oso{Naranja has acertado 1 seguidas!! Puntos HOY: 284549, SEMANA: 284549 y MES: 284549
[17:29] Libelula{Paciente This is #Mexico, I am your host Libelula{Paciente, running Libelula{Paciente [17:29] Libelula{Paciente
This is #Mexico, I am your host Libelula{Paciente, running Libelula{Paciente
[17:29] Libelula{Paciente Tri.12385 Biologiaɓebosin˿CUALbSOBRA?(PISTA:bHayf4bmoluscoswyfunocrustᣥo)bCaracol,blapa,bcalamar,balmeja,blangostino?b?b [17:29] Libelula{Paciente
Tri.12385 Biologiaɓebosin˿CUALbSOBRA?(PISTA:bHayf4bmoluscoswyfunocrustᣥo)bCaracol,blapa,bcalamar,balmeja,blangostino?b?b
[17:29] Libelula{Paciente 1 Pista: ********** Valor pregunta : 8466 Puntos [17:29] Libelula{Paciente
1 Pista: ********** Valor pregunta : 8466 Puntos
[17:29] Libelula{Paciente 2 Pista: lan******* 30 segundos y 8466 Puntos [17:29] Libelula{Paciente
2 Pista: lan******* 30 segundos y 8466 Puntos
[17:29] Cocodrilo\Suave longostino [17:29] Cocodrilo\Suave
longostino
[17:29] Oso{Naranja langostino [17:29] Oso{Naranja
langostino
[17:29] Libelula{Paciente �Bien Oso{Naranja!! Tu respuesta: "langostino" es correcta y ganas �466�12 puntos [17:29] Libelula{Paciente
�Bien Oso{Naranja!! Tu respuesta: "langostino" es correcta y ganas �466�12 puntos
[17:29] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:29] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:29] Libelula{Paciente Oso{Naranja has acertado 2 seguidas!! Puntos HOY: 293015, SEMANA: 293015 y MES: 293015 [17:29] Libelula{Paciente
Oso{Naranja has acertado 2 seguidas!! Puntos HOY: 293015, SEMANA: 293015 y MES: 293015
[17:30] Libelula{Paciente This WEEKS Top 11-20: - #11: Oso{Naranja 277533 #12: HeaLth_Rider 267851 #13: wilby 87595 #14: Cobaya{Letal12 85108 #15: welcome3 74396 #16: joooooovencito_67 54103 #17: Elefante{Humilde 44016 #18: RuBeN_Mty- 39820 #19: cubanito 31826 #20: LeCaTwaLk_z 25000 [17:30] Libelula{Paciente
This WEEKS Top 11-20: - #11: Oso{Naranja 277533 #12: HeaLth_Rider 267851 #13: wilby 87595 #14: Cobaya{Letal12 85108 #15: welcome3 74396 #16: joooooovencito_67 54103 #17: Elefante{Humilde 44016 #18: RuBeN_Mty- 39820 #19: cubanito 31826 #20: LeCaTwaLk_z 25000
[17:30] Libelula{Paciente Tri.4526 Fisica-QuimicaɇaNDaLF˿ALEACIoNbDEbCOBREb(MIN.75bporhciento)bYbESTA񏃰1bDEbFaCILbFUSIoN,bPERObMaSbDURAbYbTENAZbQUEbELbCOBREb?b [17:30] Libelula{Paciente
Tri.4526 Fisica-QuimicaɇaNDaLF˿ALEACIoNbDEbCOBREb(MIN.75bporhciento)bYbESTA񏃰1bDEbFaCILbFUSIoN,bPERObMaSbDURAbYbTENAZbQUEbELbCOBREb?b
[17:30] Libelula{Paciente 1 Pista: ****** Valor pregunta : 6407 Puntos [17:30] Libelula{Paciente
1 Pista: ****** Valor pregunta : 6407 Puntos
[17:30] Oso{Naranja bronce [17:30] Oso{Naranja
bronce
[17:30] Libelula{Paciente �Ol頃04Oso{Naranja!! Has contestado: "bronce" en �2.796 segundos y sumas �407�12 puntos a tu marcador. �Sigue as� [17:30] Libelula{Paciente
�Ol頃04Oso{Naranja!! Has contestado: "bronce" en �2.796 segundos y sumas �407�12 puntos a tu marcador. �Sigue as�
[17:30] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:30] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:30] Libelula{Paciente Oso{Naranja has acertado 3 seguidas!! Puntos HOY: 299422, SEMANA: 299422 y MES: 299422 [17:30] Libelula{Paciente
Oso{Naranja has acertado 3 seguidas!! Puntos HOY: 299422, SEMANA: 299422 y MES: 299422
[17:30] Libelula{Paciente Please remember this is a FREE service, Please do not complain [17:30] Libelula{Paciente
Please remember this is a FREE service, Please do not complain
[17:30] Libelula{Paciente Tri.3581 Gastronomiaɍercedes˿Laccarnefdefqu郰1ganimallsefestჰ1ghaciendovfamosacenqEspa񡮮.g?g [17:30] Libelula{Paciente
Tri.3581 Gastronomiaɍercedes˿Laccarnefdefqu郰1ganimallsefestჰ1ghaciendovfamosacenqEspa񡮮.g?g
[17:30] Libelula{Paciente 1 Pista: ******** Valor pregunta : 13063 Puntos [17:30] Libelula{Paciente
1 Pista: ******** Valor pregunta : 13063 Puntos
[17:30] Libelula{Paciente 2 Pista: ave***** 30 segundos y 13063 Puntos [17:30] Libelula{Paciente
2 Pista: ave***** 30 segundos y 13063 Puntos
[17:30] Oso{Naranja pista [17:30] Oso{Naranja
pista
[17:30] Libelula{Paciente �Enhorabuena Oso{Naranja!! Has contestado "avestruz" y por ello has ganado �3063�12 puntos [17:30] Libelula{Paciente
�Enhorabuena Oso{Naranja!! Has contestado "avestruz" y por ello has ganado �3063�12 puntos
[17:30] Oso{Naranja avestruz [17:30] Oso{Naranja
avestruz
[17:30] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:30] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:30] Libelula{Paciente Oso{Naranja has acertado 4 seguidas!! Puntos HOY: 312485, SEMANA: 312485 y MES: 312485 [17:30] Libelula{Paciente
Oso{Naranja has acertado 4 seguidas!! Puntos HOY: 312485, SEMANA: 312485 y MES: 312485
[17:31] Libelula{Paciente This MONTHS Top 11-20: - #11: Cobaya{Letal 734344 #12: NN_vOx_Infierno-Fiscal 407404 #13: Unheimlich 343574 #14: kitana_- 299678 #15: Guerrero08 297002 #16: HeaLth_Rider 289123 #17: Oso{Naranja 284549 #18: KaZuMa_KiRyU 258500 #19: apolomx 201118 #20: Sirena__ 184577 [17:31] Libelula{Paciente
This MONTHS Top 11-20: - #11: Cobaya{Letal 734344 #12: NN_vOx_Infierno-Fiscal 407404 #13: Unheimlich 343574 #14: kitana_- 299678 #15: Guerrero08 297002 #16: HeaLth_Rider 289123 #17: Oso{Naranja 284549 #18: KaZuMa_KiRyU 258500 #19: apolomx 201118 #20: Sirena__ 184577
[17:31] Libelula{Paciente Tri.11654 CineɔeLaRaNhA˿Directoradez"Tiovivozc.f1950"f?f [17:31] Libelula{Paciente
Tri.11654 CineɔeLaRaNhA˿Directoradez"Tiovivozc.f1950"f?f
[17:31] Libelula{Paciente 1 Pista: **** **** ***** Valor pregunta : 13231 Puntos [17:31] Libelula{Paciente
1 Pista: **** **** ***** Valor pregunta : 13231 Puntos
[17:31] Libelula{Paciente 2 Pista: jos* **** ***** 30 segundos y 13231 Puntos [17:31] Libelula{Paciente
2 Pista: jos* **** ***** 30 segundos y 13231 Puntos
[17:31] Cocodrilo\Suave jose luis garcia [17:31] Cocodrilo\Suave
jose luis garcia
[17:31] Oso{Naranja es tuya [17:31] Oso{Naranja
es tuya
[17:31] Libelula{Paciente 3 Pista: jose *ui* *a**i 15 segundos y 13231 Puntos [17:31] Libelula{Paciente
3 Pista: jose *ui* *a**i 15 segundos y 13231 Puntos
[17:31] Oso{Naranja jose luis maria [17:31] Oso{Naranja
jose luis maria
[17:31] Libelula{Paciente Tiempo! La respuesta es -> jose�uis�arci <- [17:31] Libelula{Paciente
Tiempo! La respuesta es -> jose�uis�arci <-
[17:31] Cocodrilo\Suave jose luis gardi [17:31] Cocodrilo\Suave
jose luis gardi
[17:31] Libelula{Paciente R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: Cocodrilo\Suave 7226244 [17:31] Libelula{Paciente
R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: Cocodrilo\Suave 7226244
[17:31] Libelula{Paciente Tri.7222 Cienciaɒadian˿Dispositivohelectronicohqueepermiteepasarblaacorrienteeeniunisentidohyplohimpideeenielkcontrarioh?w [17:31] Libelula{Paciente
Tri.7222 Cienciaɒadian˿Dispositivohelectronicohqueepermiteepasarblaacorrienteeeniunisentidohyplohimpideeenielkcontrarioh?w
[17:31] Libelula{Paciente 1 Pista: ***** Valor pregunta : 15878 Puntos [17:31] Libelula{Paciente
1 Pista: ***** Valor pregunta : 15878 Puntos
[17:32] Libelula{Paciente 2 Pista: dio** 30 segundos y 15878 Puntos [17:32] Libelula{Paciente
2 Pista: dio** 30 segundos y 15878 Puntos
[17:32] Cocodrilo\Suave diodo [17:32] Cocodrilo\Suave
diodo
[17:32] Libelula{Paciente �Bingo!! Cocodrilo\Suave dio la respuesta: "diodo" en �8.75 segundos e incrementa sus ganancias con �5878�12 puntos [17:32] Libelula{Paciente
�Bingo!! Cocodrilo\Suave dio la respuesta: "diodo" en �8.75 segundos e incrementa sus ganancias con �5878�12 puntos
[17:32] Libelula{Paciente ACTION awards Cocodrilo\Suave with a +v for having over 15000 points [17:32] Libelula{Paciente
ACTION awards Cocodrilo\Suave with a +v for having over 15000 points
[17:32] Libelula{Paciente Cocodrilo\Suave has acertado 1 seguidas!! Puntos HOY: 994597, SEMANA: 7837558 y MES: 15063802 [17:32] Libelula{Paciente
Cocodrilo\Suave has acertado 1 seguidas!! Puntos HOY: 994597, SEMANA: 7837558 y MES: 15063802
[17:32] Libelula{Paciente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [17:32] Libelula{Paciente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[17:32] Libelula{Paciente Tri.19171 Informaticaɐax˿CualqesaelqprogramahmasasimplecdelqWindowsa98nparahusartTelnetv?n [17:32] Libelula{Paciente
Tri.19171 Informaticaɐax˿CualqesaelqprogramahmasasimplecdelqWindowsa98nparahusartTelnetv?n
[17:32] Libelula{Paciente 1 Pista: ******.*** Valor pregunta : 20201 Puntos [17:32] Libelula{Paciente
1 Pista: ******.*** Valor pregunta : 20201 Puntos
[17:32] Libelula{Paciente 2 Pista: tel***.*** 30 segundos y 20201 Puntos [17:32] Libelula{Paciente
2 Pista: tel***.*** 30 segundos y 20201 Puntos
[17:32] Libelula{Paciente 3 Pista: tel*e*.e*e 15 segundos y 20201 Puntos [17:32] Libelula{Paciente
3 Pista: tel*e*.e*e 15 segundos y 20201 Puntos
[17:33] Libelula{Paciente Tiempo! La respuesta es -> telnet.exe <- [17:33] Libelula{Paciente
Tiempo! La respuesta es -> telnet.exe <-
[17:33] Libelula{Paciente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [17:33] Libelula{Paciente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[17:33] Libelula{Paciente Tri.14104 Cineɋorynna˿Comozseqllamafelkpersonajeqdelkasesinozdeq"Halloweenm?b [17:33] Libelula{Paciente
Tri.14104 Cineɋorynna˿Comozseqllamafelkpersonajeqdelkasesinozdeq"Halloweenm?b
[17:33] Libelula{Paciente 1 Pista: ******* ***** Valor pregunta : 22942 Puntos [17:33] Libelula{Paciente
1 Pista: ******* ***** Valor pregunta : 22942 Puntos
[17:33] Oso{Naranja ni idea [17:33] Oso{Naranja
ni idea
[17:33] Libelula{Paciente 2 Pista: mic**** ***** 30 segundos y 22942 Puntos [17:33] Libelula{Paciente
2 Pista: mic**** ***** 30 segundos y 22942 Puntos
[17:33] Libelula{Paciente 3 Pista: mic*ae* **e** 15 segundos y 22942 Puntos [17:33] Libelula{Paciente
3 Pista: mic*ae* **e** 15 segundos y 22942 Puntos
[17:34] Libelula{Paciente Tiempo! La respuesta es -> michael�yers <- [17:34] Libelula{Paciente
Tiempo! La respuesta es -> michael�yers <-
[17:34] Libelula{Paciente R᮫ing SEMANA: - #1: Cocodrilo\Suave 7837558 #2: {FoSFoRiTa} 5002753 #3: Karen 3690094 #4: Alii 1994438 #5: Danielitto 1424982 #6: Ketzy 1150014 #7: NN_vOx-14_Lagrimas-Progres 981673 #8: Cobaya{Letal 734344 #9: Grillo}Respetable 473023 #10: Unheimlich 343574 [17:34] Libelula{Paciente
R᮫ing SEMANA: - #1: Cocodrilo\Suave 7837558 #2: {FoSFoRiTa} 5002753 #3: Karen 3690094 #4: Alii 1994438 #5: Danielitto 1424982 #6: Ketzy 1150014 #7: NN_vOx-14_Lagrimas-Progres 981673 #8: Cobaya{Letal 734344 #9: Grillo}Respetable 473023 #10: Unheimlich 343574
[17:34] Libelula{Paciente Tri.14851 GastronomiaɂBoy˿DEqQUEqCIUDADqESqLAqCERVEZA:qNEWCASTLEqBROWNqALEq?q [17:34] Libelula{Paciente
Tri.14851 GastronomiaɂBoy˿DEqQUEqCIUDADqESqLAqCERVEZA:qNEWCASTLEqBROWNqALEq?q
[17:34] Libelula{Paciente 1 Pista: ********* Valor pregunta : 18622 Puntos [17:34] Libelula{Paciente
1 Pista: ********* Valor pregunta : 18622 Puntos
[17:34] Libelula{Paciente 2 Pista: new****** 30 segundos y 18622 Puntos [17:34] Libelula{Paciente
2 Pista: new****** 30 segundos y 18622 Puntos
[17:34] Libelula{Paciente �Est᳠que lo tiras Oso{Naranja!! ߃󭯠supiste que "newcastle" era la respuesta? Venga, �8622�12 puntos suben a tu marcador [17:34] Libelula{Paciente
�Est᳠que lo tiras Oso{Naranja!! ߃󭯠supiste que "newcastle" era la respuesta? Venga, �8622�12 puntos suben a tu marcador
[17:34] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:34] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:34] Libelula{Paciente Oso{Naranja has acertado 1 seguidas!! Puntos HOY: 331107, SEMANA: 331107 y MES: 331107 [17:34] Libelula{Paciente
Oso{Naranja has acertado 1 seguidas!! Puntos HOY: 331107, SEMANA: 331107 y MES: 331107
[17:34] Oso{Naranja newcastle [17:34] Oso{Naranja
newcastle
[17:34] Libelula{Paciente We feature over 50,000 Q&A ! [17:34] Libelula{Paciente
We feature over 50,000 Q&A !
[17:34] Libelula{Paciente Tri.733 Geografiaɂatval˿CUANTOSsRIOSsDESEMBOCANsENsELsMEDITERRANEO?s?s [17:34] Libelula{Paciente
Tri.733 Geografiaɂatval˿CUANTOSsRIOSsDESEMBOCANsENsELsMEDITERRANEO?s?s
[17:34] Libelula{Paciente 1 Pista: ** Valor pregunta : 8505 Puntos [17:34] Libelula{Paciente
1 Pista: ** Valor pregunta : 8505 Puntos
[17:35] Libelula{Paciente 2 Pista: 69 30 segundos y 8505 Puntos [17:35] Libelula{Paciente
2 Pista: 69 30 segundos y 8505 Puntos
[17:35] Cocodrilo\Suave 69 [17:35] Cocodrilo\Suave
69
[17:35] Libelula{Paciente �Absolutamente correcto Cocodrilo\Suave!! Acertaste "69" en �8.844 segundos y ganas �505�12 puntos [17:35] Libelula{Paciente
�Absolutamente correcto Cocodrilo\Suave!! Acertaste "69" en �8.844 segundos y ganas �505�12 puntos
[17:35] Libelula{Paciente ACTION awards Cocodrilo\Suave with a +v for having over 15000 points [17:35] Libelula{Paciente
ACTION awards Cocodrilo\Suave with a +v for having over 15000 points
[17:35] Libelula{Paciente Cocodrilo\Suave has acertado 1 seguidas!! Puntos HOY: 1003102, SEMANA: 7846063 y MES: 15072307 [17:35] Libelula{Paciente
Cocodrilo\Suave has acertado 1 seguidas!! Puntos HOY: 1003102, SEMANA: 7846063 y MES: 15072307
[17:35] Libelula{Paciente Tri.5536 Musicaɐsico666ˮombrebdelnprotagonistagdeb"Lagmᱵinagblanda"r?r [17:35] Libelula{Paciente
Tri.5536 Musicaɐsico666ˮombrebdelnprotagonistagdeb"Lagmᱵinagblanda"r?r
[17:35] Libelula{Paciente 1 Pista: ***** ***** ***** Valor pregunta : 19673 Puntos [17:35] Libelula{Paciente
1 Pista: ***** ***** ***** Valor pregunta : 19673 Puntos
[17:35] Libelula{Paciente 2 Pista: chi** ***** ***** 30 segundos y 19673 Puntos [17:35] Libelula{Paciente
2 Pista: chi** ***** ***** 30 segundos y 19673 Puntos
[17:35] Libelula{Paciente 3 Pista: chi*o *ea** *e*a* 15 segundos y 19673 Puntos [17:35] Libelula{Paciente
3 Pista: chi*o *ea** *e*a* 15 segundos y 19673 Puntos
[17:36] Libelula{Paciente Tiempo! La respuesta es -> chico�eavy�etal <- [17:36] Libelula{Paciente
Tiempo! La respuesta es -> chico�eavy�etal <-
[17:36] Libelula{Paciente Tri.5321 Cienciaɐsico666˶ientopsuaveldelbponientel?k [17:36] Libelula{Paciente
Tri.5321 Cienciaɐsico666˶ientopsuaveldelbponientel?k
[17:36] Libelula{Paciente 1 Pista: ****** Valor pregunta : 10131 Puntos [17:36] Libelula{Paciente
1 Pista: ****** Valor pregunta : 10131 Puntos
[17:36] Cocodrilo\Suave aurora [17:36] Cocodrilo\Suave
aurora
[17:36] Libelula{Paciente 2 Pista: cef*** 30 segundos y 10131 Puntos [17:36] Libelula{Paciente
2 Pista: cef*** 30 segundos y 10131 Puntos
[17:36] Grillo}Respetable buenos dias [17:36] Grillo}Respetable
buenos dias
[17:36] Oso{Naranja cefiro [17:36] Oso{Naranja
cefiro
[17:36] Grillo}Respetable buenas tardes [17:36] Grillo}Respetable
buenas tardes
[17:36] Libelula{Paciente �Ol頃04Oso{Naranja!! Has contestado: "cefiro" en �9.141 segundos y sumas �0131�12 puntos a tu marcador. �Sigue as� [17:36] Libelula{Paciente
�Ol頃04Oso{Naranja!! Has contestado: "cefiro" en �9.141 segundos y sumas �0131�12 puntos a tu marcador. �Sigue as�
[17:36] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:36] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:36] Libelula{Paciente Oso{Naranja has acertado 1 seguidas!! Puntos HOY: 341238, SEMANA: 341238 y MES: 341238 [17:36] Libelula{Paciente
Oso{Naranja has acertado 1 seguidas!! Puntos HOY: 341238, SEMANA: 341238 y MES: 341238
[17:36] Cocodrilo\Suave cefiro [17:36] Cocodrilo\Suave
cefiro
[17:36] Oso{Naranja buenos dias Grillo}Respetable [17:36] Oso{Naranja
buenos dias Grillo}Respetable
[17:36] Libelula{Paciente Please remember this is a FREE service, Please do not complain [17:36] Libelula{Paciente
Please remember this is a FREE service, Please do not complain
[17:36] Libelula{Paciente Tri.7712 Fisica-QuimicaɌocko˿Cuᮤofentrexdosgpuntosgdexunnconductornexistexlatmismattensi󮬡lrcolocarnelrconductornennunncampofmagn鴩cofaparecexunatdiferenciatdextensi󮃰1nsexdenominat?n [17:36] Libelula{Paciente
Tri.7712 Fisica-QuimicaɌocko˿Cuᮤofentrexdosgpuntosgdexunnconductornexistexlatmismattensi󮬡lrcolocarnelrconductornennunncampofmagn鴩cofaparecexunatdiferenciatdextensi󮃰1nsexdenominat?n
[17:36] Libelula{Paciente 1 Pista: ****** ** **** Valor pregunta : 11002 Puntos [17:36] Libelula{Paciente
1 Pista: ****** ** **** Valor pregunta : 11002 Puntos
[17:36] Grillo}Respetable hola Oso{Naranja [17:36] Grillo}Respetable
hola Oso{Naranja
[17:37] Libelula{Paciente 2 Pista: efe*** ** **** 30 segundos y 11002 Puntos [17:37] Libelula{Paciente
2 Pista: efe*** ** **** 30 segundos y 11002 Puntos
[17:37] Oso{Naranja :] (y) [17:37] Oso{Naranja
:] (y)
[17:37] Libelula{Paciente 3 Pista: efe**o *e *a** 15 segundos y 11002 Puntos [17:37] Libelula{Paciente
3 Pista: efe**o *e *a** 15 segundos y 11002 Puntos
[17:37] Libelula{Paciente Tiempo! La respuesta es -> efecto�e�all <- [17:37] Libelula{Paciente
Tiempo! La respuesta es -> efecto�e�all <-
[17:37] Oso{Naranja muy larga la pregunta [17:37] Oso{Naranja
muy larga la pregunta
[17:37] Libelula{Paciente R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: {FoSFoRiTa} 30927547 #4: Grillo}Respetable 16843241 #5: Karen 14172663 [17:37] Libelula{Paciente
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: {FoSFoRiTa} 30927547 #4: Grillo}Respetable 16843241 #5: Karen 14172663
[17:37] Libelula{Paciente Tri.7328 Deporteɲaziel9˿BALONCESTO:ENjQUEjEQUIPOjESTABAjENj2003/04jELjJUGADORjSOULEYjDRAMEj?j [17:37] Libelula{Paciente
Tri.7328 Deporteɲaziel9˿BALONCESTO:ENjQUEjEQUIPOjESTABAjENj2003/04jELjJUGADORjSOULEYjDRAMEj?j
[17:37] Libelula{Paciente 1 Pista: *** ******** Valor pregunta : 13657 Puntos [17:37] Libelula{Paciente
1 Pista: *** ******** Valor pregunta : 13657 Puntos
[17:37] Libelula{Paciente 2 Pista: dkv ******** 30 segundos y 13657 Puntos [17:37] Libelula{Paciente
2 Pista: dkv ******** 30 segundos y 13657 Puntos
[17:37] Oso{Naranja fcb barcelona [17:37] Oso{Naranja
fcb barcelona
[17:38] Grillo}Respetable dkv joventut [17:38] Grillo}Respetable
dkv joventut
[17:38] Libelula{Paciente �Bien Grillo}Respetable!! Tu respuesta: "dkv joventut" es correcta y ganas �3657�12 puntos [17:38] Libelula{Paciente
�Bien Grillo}Respetable!! Tu respuesta: "dkv joventut" es correcta y ganas �3657�12 puntos
[17:38] Oso{Naranja dkv dinamo [17:38] Oso{Naranja
dkv dinamo
[17:38] Libelula{Paciente Grillo}Respetable has acertado 1 seguidas!! Puntos HOY: 13657, SEMANA: 486680 y MES: 4151907 [17:38] Libelula{Paciente
Grillo}Respetable has acertado 1 seguidas!! Puntos HOY: 13657, SEMANA: 486680 y MES: 4151907
[17:38] Libelula{Paciente If you think a Q&A is wrong, please call an OP [17:38] Libelula{Paciente
If you think a Q&A is wrong, please call an OP
[17:38] Libelula{Paciente Tri.16848 Medicina-Saludɒolo˿Enfermedadiqueycausahlahbacteriah"ChlamydiahPsittaci"c?c [17:38] Libelula{Paciente
Tri.16848 Medicina-Saludɒolo˿Enfermedadiqueycausahlahbacteriah"ChlamydiahPsittaci"c?c
[17:38] Libelula{Paciente 1 Pista: ********** Valor pregunta : 12203 Puntos [17:38] Libelula{Paciente
1 Pista: ********** Valor pregunta : 12203 Puntos
[17:38] Libelula{Paciente 2 Pista: psi******* 30 segundos y 12203 Puntos [17:38] Libelula{Paciente
2 Pista: psi******* 30 segundos y 12203 Puntos
[17:38] Libelula{Paciente 3 Pista: psi*a*o*i* 15 segundos y 12203 Puntos [17:38] Libelula{Paciente
3 Pista: psi*a*o*i* 15 segundos y 12203 Puntos
[17:38] Oso{Naranja .. [17:38] Oso{Naranja
..
[17:39] Cocodrilo\Suave psicologia [17:39] Cocodrilo\Suave
psicologia
[17:39] Libelula{Paciente Tiempo! La respuesta es -> psitacosis <- [17:39] Libelula{Paciente
Tiempo! La respuesta es -> psitacosis <-
[17:39] Oso{Naranja ni idea [17:39] Oso{Naranja
ni idea
[17:39] Libelula{Paciente R᮫ing por D́: - Domingo: Ketzy 1150014 Lunes: Karen 1245745 Martes: {FoSFoRiTa} 388010 Miercoles: Cocodrilo\Suave 2638625 Jueves: Karen 824895 Viernes: Cocodrilo\Suave 2430737 Sᢡdo: welcome3 3286708 [17:39] Libelula{Paciente
R᮫ing por D́: - Domingo: Ketzy 1150014 Lunes: Karen 1245745 Martes: {FoSFoRiTa} 388010 Miercoles: Cocodrilo\Suave 2638625 Jueves: Karen 824895 Viernes: Cocodrilo\Suave 2430737 Sᢡdo: welcome3 3286708
[17:39] Libelula{Paciente Tri.18747 MitologiaɄivah˿DIOSAcGRIEGAcDEcLAcCURACIoNc?c [17:39] Libelula{Paciente
Tri.18747 MitologiaɄivah˿DIOSAcGRIEGAcDEcLAcCURACIoNc?c
[17:39] Libelula{Paciente 1 Pista: ******* Valor pregunta : 20276 Puntos [17:39] Libelula{Paciente
1 Pista: ******* Valor pregunta : 20276 Puntos
[17:39] Cocodrilo\Suave higia [17:39] Cocodrilo\Suave
higia
[17:39] Libelula{Paciente 2 Pista: sot**** 30 segundos y 20276 Puntos [17:39] Libelula{Paciente
2 Pista: sot**** 30 segundos y 20276 Puntos
[17:39] Cocodrilo\Suave hygeia [17:39] Cocodrilo\Suave
hygeia
[17:39] Libelula{Paciente 3 Pista: sote*ia 15 segundos y 20276 Puntos [17:39] Libelula{Paciente
3 Pista: sote*ia 15 segundos y 20276 Puntos
[17:39] Libelula{Paciente �As�e hace Oso{Naranja!! Contestaste "soteria" en �4.531 segundos y sumas �0276�12 puntos [17:39] Libelula{Paciente
�As�e hace Oso{Naranja!! Contestaste "soteria" en �4.531 segundos y sumas �0276�12 puntos
[17:39] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:39] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:39] Libelula{Paciente Oso{Naranja has acertado 1 seguidas!! Puntos HOY: 361514, SEMANA: 361514 y MES: 361514 [17:39] Libelula{Paciente
Oso{Naranja has acertado 1 seguidas!! Puntos HOY: 361514, SEMANA: 361514 y MES: 361514
[17:39] Oso{Naranja soteria [17:39] Oso{Naranja
soteria
[17:39] Oso{Naranja XD [17:39] Oso{Naranja
XD
[17:39] Libelula{Paciente For The Competitive Edge type !pingme [17:39] Libelula{Paciente
For The Competitive Edge type !pingme
[17:39] Libelula{Paciente Tri.10932 Geografiaɣarlovigo˿EnzquedoceanohsituariasblasbIslasbMaldivas?c?c [17:39] Libelula{Paciente
Tri.10932 Geografiaɣarlovigo˿EnzquedoceanohsituariasblasbIslasbMaldivas?c?c
[17:39] Libelula{Paciente 1 Pista: ****** Valor pregunta : 16863 Puntos [17:39] Libelula{Paciente
1 Pista: ****** Valor pregunta : 16863 Puntos
[17:40] Oso{Naranja pacifico [17:40] Oso{Naranja
pacifico
[17:40] Oso{Naranja indico [17:40] Oso{Naranja
indico
[17:40] Libelula{Paciente �Enhorabuena Oso{Naranja!! Has contestado "indico" y por ello has ganado �6863�12 puntos [17:40] Libelula{Paciente
�Enhorabuena Oso{Naranja!! Has contestado "indico" y por ello has ganado �6863�12 puntos
[17:40] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:40] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:40] Libelula{Paciente Oso{Naranja has acertado 2 seguidas!! Puntos HOY: 378377, SEMANA: 378377 y MES: 378377 [17:40] Libelula{Paciente
Oso{Naranja has acertado 2 seguidas!! Puntos HOY: 378377, SEMANA: 378377 y MES: 378377
[17:40] Cocodrilo\Suave indico [17:40] Cocodrilo\Suave
indico
[17:40] Libelula{Paciente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [17:40] Libelula{Paciente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[17:40] Libelula{Paciente Tri.15116 Historiaɳubmarin˿Cualkfuegelkprimerlantipapabdeglabhistoria?f?f [17:40] Libelula{Paciente
Tri.15116 Historiaɳubmarin˿Cualkfuegelkprimerlantipapabdeglabhistoria?f?f
[17:40] Libelula{Paciente 1 Pista: ********* Valor pregunta : 7554 Puntos [17:40] Libelula{Paciente
1 Pista: ********* Valor pregunta : 7554 Puntos
[17:40] Libelula{Paciente 2 Pista: nov****** 30 segundos y 7554 Puntos [17:40] Libelula{Paciente
2 Pista: nov****** 30 segundos y 7554 Puntos
[17:40] Oso{Naranja hipolito [17:40] Oso{Naranja
hipolito
[17:40] Libelula{Paciente 3 Pista: nova*ia*o 15 segundos y 7554 Puntos [17:40] Libelula{Paciente
3 Pista: nova*ia*o 15 segundos y 7554 Puntos
[17:41] Oso{Naranja novariato [17:41] Oso{Naranja
novariato
[17:41] Oso{Naranja novariaco [17:41] Oso{Naranja
novariaco
[17:41] Libelula{Paciente Tiempo! La respuesta es -> novaciano <- [17:41] Libelula{Paciente
Tiempo! La respuesta es -> novaciano <-
[17:41] Cocodrilo\Suave quizas quien fue ese degenerado [17:41] Cocodrilo\Suave
quizas quien fue ese degenerado
[17:41] Oso{Naranja jaja [17:41] Oso{Naranja
jaja
[17:41] Libelula{Paciente R᮫ing MES: - #1: welcome3 21243832 #2: Cocodrilo\Suave 15072307 #3: Danielitto 10886756 #4: Karen 9086159 #5: {FoSFoRiTa} 7343057 #6: Alii 5900389 #7: Grillo}Respetable 4151907 #8: Ketzy 1150014 #9: NN_vOx-14_Lagrimas-Progres 981673 #10: NN_vOx_Bukelizacion-YA 839312 [17:41] Libelula{Paciente
R᮫ing MES: - #1: welcome3 21243832 #2: Cocodrilo\Suave 15072307 #3: Danielitto 10886756 #4: Karen 9086159 #5: {FoSFoRiTa} 7343057 #6: Alii 5900389 #7: Grillo}Respetable 4151907 #8: Ketzy 1150014 #9: NN_vOx-14_Lagrimas-Progres 981673 #10: NN_vOx_Bukelizacion-YA 839312
[17:41] Libelula{Paciente Tri.6846 Historiaɳubmarin˿Cuallfueqellprimerdportaavionesbespa񯬿x?x [17:41] Libelula{Paciente
Tri.6846 Historiaɳubmarin˿Cuallfueqellprimerdportaavionesbespa񯬿x?x
[17:41] Libelula{Paciente 1 Pista: ****** Valor pregunta : 24410 Puntos [17:41] Libelula{Paciente
1 Pista: ****** Valor pregunta : 24410 Puntos
[17:41] Libelula{Paciente 2 Pista: ded*** 30 segundos y 24410 Puntos [17:41] Libelula{Paciente
2 Pista: ded*** 30 segundos y 24410 Puntos
[17:41] Cocodrilo\Suave dedalo [17:41] Cocodrilo\Suave
dedalo
[17:41] Libelula{Paciente �e nota que sabes mucho de esto Oso{Naranja! Tu respuesta "dedalo" es correcta y ganas �4410�12 puntos [17:41] Libelula{Paciente
�e nota que sabes mucho de esto Oso{Naranja! Tu respuesta "dedalo" es correcta y ganas �4410�12 puntos
[17:41] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:41] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:41] Libelula{Paciente Oso{Naranja has acertado 3 seguidas!! Puntos HOY: 402787, SEMANA: 402787 y MES: 402787 [17:41] Libelula{Paciente
Oso{Naranja has acertado 3 seguidas!! Puntos HOY: 402787, SEMANA: 402787 y MES: 402787
[17:41] Oso{Naranja dedalo [17:41] Oso{Naranja
dedalo
[17:41] Oso{Naranja icaro [17:41] Oso{Naranja
icaro
[17:41] Libelula{Paciente Please refrain from using Extreme Bad Language [17:41] Libelula{Paciente
Please refrain from using Extreme Bad Language
[17:41] Libelula{Paciente Tri.2510 LiteraturaɁcuarios˿AUTORyDEyLUISONy?y [17:41] Libelula{Paciente
Tri.2510 LiteraturaɁcuarios˿AUTORyDEyLUISONy?y
[17:41] Libelula{Paciente 1 Pista: ******* ***** ***** Pregunta de BONUS : 100000 Puntos [17:41] Libelula{Paciente
1 Pista: ******* ***** ***** Pregunta de BONUS : 100000 Puntos
[17:42] Oso{Naranja que es luison? [17:42] Oso{Naranja
que es luison?
[17:42] Libelula{Paciente 2 Pista: alf**** ***** ***** 30 segundos y 100000 Puntos [17:42] Libelula{Paciente
2 Pista: alf**** ***** ***** 30 segundos y 100000 Puntos
[17:42] Oso{Naranja paso [17:42] Oso{Naranja
paso
[17:42] Libelula{Paciente 3 Pista: alf*e*o *o*e* *e**a 15 segundos y 100000 Puntos [17:42] Libelula{Paciente
3 Pista: alf*e*o *o*e* *e**a 15 segundos y 100000 Puntos
[17:42] Libelula{Paciente Tiempo! La respuesta es -> alfredo�omez�erda <- [17:42] Libelula{Paciente
Tiempo! La respuesta es -> alfredo�omez�erda <-
[17:42] Libelula{Paciente This is #Mexico, I am your host Libelula{Paciente, running Libelula{Paciente [17:42] Libelula{Paciente
This is #Mexico, I am your host Libelula{Paciente, running Libelula{Paciente
[17:42] Libelula{Paciente Tri.12377 DeporteɔeLaRaNhA˿GanadorddeloTourddeaFranciab2000g?g [17:42] Libelula{Paciente
Tri.12377 DeporteɔeLaRaNhA˿GanadorddeloTourddeaFranciab2000g?g
[17:42] Libelula{Paciente 1 Pista: ***** ********* Valor pregunta : 11736 Puntos [17:42] Libelula{Paciente
1 Pista: ***** ********* Valor pregunta : 11736 Puntos
[17:42] Oso{Naranja paso [17:42] Oso{Naranja
paso
[17:42] Libelula{Paciente 2 Pista: lan** ********* 30 segundos y 11736 Puntos [17:42] Libelula{Paciente
2 Pista: lan** ********* 30 segundos y 11736 Puntos
[17:43] Cocodrilo\Suave tadej pogacar [17:43] Cocodrilo\Suave
tadej pogacar
[17:43] Libelula{Paciente 3 Pista: lan*e a*****o** 15 segundos y 11736 Puntos [17:43] Libelula{Paciente
3 Pista: lan*e a*****o** 15 segundos y 11736 Puntos
[17:43] Libelula{Paciente �Muy bien Grillo}Respetable!! Acertaste "lance armstrong" en tan s󬯠�7.5 segundos y por eso has ganado: �1736�12 puntos [17:43] Libelula{Paciente
�Muy bien Grillo}Respetable!! Acertaste "lance armstrong" en tan s󬯠�7.5 segundos y por eso has ganado: �1736�12 puntos
[17:43] Libelula{Paciente Grillo}Respetable has acertado 1 seguidas!! Puntos HOY: 25393, SEMANA: 498416 y MES: 4163643 [17:43] Libelula{Paciente
Grillo}Respetable has acertado 1 seguidas!! Puntos HOY: 25393, SEMANA: 498416 y MES: 4163643
[17:43] Grillo}Respetable lance armstrong [17:43] Grillo}Respetable
lance armstrong
[17:43] Libelula{Paciente This WEEKS Top 11-20: - #11: Unheimlich 343574 #12: HeaLth_Rider 267851 #13: wilby 87595 #14: Cobaya{Letal12 85108 #15: welcome3 74396 #16: joooooovencito_67 54103 #17: Elefante{Humilde 44016 #18: RuBeN_Mty- 39820 #19: cubanito 31826 #20: LeCaTwaLk_z 25000 [17:43] Libelula{Paciente
This WEEKS Top 11-20: - #11: Unheimlich 343574 #12: HeaLth_Rider 267851 #13: wilby 87595 #14: Cobaya{Letal12 85108 #15: welcome3 74396 #16: joooooovencito_67 54103 #17: Elefante{Humilde 44016 #18: RuBeN_Mty- 39820 #19: cubanito 31826 #20: LeCaTwaLk_z 25000
[17:43] Libelula{Paciente Tri.880 Informaticaɐax˿ComotsekllamarelqprogramardekWindowst98zquekpermitekaumentaroundtrozotdeklarpantallar?z [17:43] Libelula{Paciente
Tri.880 Informaticaɐax˿ComotsekllamarelqprogramardekWindowst98zquekpermitekaumentaroundtrozotdeklarpantallar?z
[17:43] Libelula{Paciente 1 Pista: ********* Valor pregunta : 5168 Puntos [17:43] Libelula{Paciente
1 Pista: ********* Valor pregunta : 5168 Puntos
[17:43] Libelula{Paciente 2 Pista: Amp****** 30 segundos y 5168 Puntos [17:43] Libelula{Paciente
2 Pista: Amp****** 30 segundos y 5168 Puntos
[17:44] Libelula{Paciente �Bingo!! Oso{Naranja dio la respuesta: "ampliador" en �9.954 segundos e incrementa sus ganancias con �168�12 puntos [17:44] Libelula{Paciente
�Bingo!! Oso{Naranja dio la respuesta: "ampliador" en �9.954 segundos e incrementa sus ganancias con �168�12 puntos
[17:44] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:44] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:44] Libelula{Paciente Oso{Naranja has acertado 1 seguidas!! Puntos HOY: 407955, SEMANA: 407955 y MES: 407955 [17:44] Libelula{Paciente
Oso{Naranja has acertado 1 seguidas!! Puntos HOY: 407955, SEMANA: 407955 y MES: 407955
[17:44] Oso{Naranja ampliador [17:44] Oso{Naranja
ampliador
[17:44] Libelula{Paciente Please remember this is a FREE service, Please do not complain [17:44] Libelula{Paciente
Please remember this is a FREE service, Please do not complain
[17:44] Libelula{Paciente Tri.9109 Historiaɴamzarian˿ConocidoyenalakactualidadwcomoyRijeka,xfuejeleprincipalepuertoydejlakCoronakH�ngarak?x [17:44] Libelula{Paciente
Tri.9109 Historiaɴamzarian˿ConocidoyenalakactualidadwcomoyRijeka,xfuejeleprincipalepuertoydejlakCoronakH�ngarak?x
[17:44] Libelula{Paciente 1 Pista: ***** Valor pregunta : 19314 Puntos [17:44] Libelula{Paciente
1 Pista: ***** Valor pregunta : 19314 Puntos
[17:44] Libelula{Paciente 2 Pista: fiu** 30 segundos y 19314 Puntos [17:44] Libelula{Paciente
2 Pista: fiu** 30 segundos y 19314 Puntos
[17:44] Libelula{Paciente �Bien Cocodrilo\Suave!! Tu respuesta: "fiume" es correcta y ganas �9314�12 puntos [17:44] Libelula{Paciente
�Bien Cocodrilo\Suave!! Tu respuesta: "fiume" es correcta y ganas �9314�12 puntos
[17:44] Libelula{Paciente ACTION awards Cocodrilo\Suave with a +v for having over 15000 points [17:44] Libelula{Paciente
ACTION awards Cocodrilo\Suave with a +v for having over 15000 points
[17:44] Libelula{Paciente Cocodrilo\Suave has acertado 1 seguidas!! Puntos HOY: 1022416, SEMANA: 7865377 y MES: 15091621 [17:44] Libelula{Paciente
Cocodrilo\Suave has acertado 1 seguidas!! Puntos HOY: 1022416, SEMANA: 7865377 y MES: 15091621
[17:44] Cocodrilo\Suave fiume [17:44] Cocodrilo\Suave
fiume
[17:44] Libelula{Paciente This MONTHS Top 11-20: - #11: Cobaya{Letal 734344 #12: NN_vOx_Infierno-Fiscal 407404 #13: Oso{Naranja 402787 #14: Unheimlich 343574 #15: kitana_- 299678 #16: Guerrero08 297002 #17: HeaLth_Rider 289123 #18: KaZuMa_KiRyU 258500 #19: apolomx 201118 #20: Sirena__ 184577 [17:44] Libelula{Paciente
This MONTHS Top 11-20: - #11: Cobaya{Letal 734344 #12: NN_vOx_Infierno-Fiscal 407404 #13: Oso{Naranja 402787 #14: Unheimlich 343574 #15: kitana_- 299678 #16: Guerrero08 297002 #17: HeaLth_Rider 289123 #18: KaZuMa_KiRyU 258500 #19: apolomx 201118 #20: Sirena__ 184577
[17:44] Libelula{Paciente Tri.996 HistoriaɊAVEA˿26-MARZO-1902:ENqQUEqCIUDADqAFRICANAqMUEREqSIRqCECILqJOHNqRHODESq?q [17:44] Libelula{Paciente
Tri.996 HistoriaɊAVEA˿26-MARZO-1902:ENqQUEqCIUDADqAFRICANAqMUEREqSIRqCECILqJOHNqRHODESq?q
[17:44] Libelula{Paciente 1 Pista: ****** *** **** Valor pregunta : 18400 Puntos [17:44] Libelula{Paciente
1 Pista: ****** *** **** Valor pregunta : 18400 Puntos
[17:44] Oso{Naranja del congo [17:44] Oso{Naranja
del congo
[17:44] Libelula{Paciente 2 Pista: CIU*** *** **** 30 segundos y 18400 Puntos [17:44] Libelula{Paciente
2 Pista: CIU*** *** **** 30 segundos y 18400 Puntos
[17:45] Oso{Naranja ciudad del cabo [17:45] Oso{Naranja
ciudad del cabo
[17:45] Libelula{Paciente �Ol頃04Oso{Naranja!! Has contestado: "ciudad del cabo" en �2.906 segundos y sumas �8400�12 puntos a tu marcador. �Sigue as� [17:45] Libelula{Paciente
�Ol頃04Oso{Naranja!! Has contestado: "ciudad del cabo" en �2.906 segundos y sumas �8400�12 puntos a tu marcador. �Sigue as�
[17:45] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:45] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:45] Libelula{Paciente Oso{Naranja has acertado 1 seguidas!! Puntos HOY: 426355, SEMANA: 426355 y MES: 426355 [17:45] Libelula{Paciente
Oso{Naranja has acertado 1 seguidas!! Puntos HOY: 426355, SEMANA: 426355 y MES: 426355
[17:45] Libelula{Paciente R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: Cocodrilo\Suave 7226244 [17:45] Libelula{Paciente
R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: Cocodrilo\Suave 7226244
[17:45] Libelula{Paciente Tri.20613 MitologiaɐEDROC˿DIVINIDADdROMANAdQUEdSEdIDENTIFICAdCONdELdDIOSdGRIEGOdHEFESTOd?d [17:45] Libelula{Paciente
Tri.20613 MitologiaɐEDROC˿DIVINIDADdROMANAdQUEdSEdIDENTIFICAdCONdELdDIOSdGRIEGOdHEFESTOd?d
[17:45] Libelula{Paciente 1 Pista: ******* Valor pregunta : 15660 Puntos [17:45] Libelula{Paciente
1 Pista: ******* Valor pregunta : 15660 Puntos
[17:45] Cocodrilo\Suave si se fue a morir lejos [17:45] Cocodrilo\Suave
si se fue a morir lejos
[17:45] Oso{Naranja vulcano [17:45] Oso{Naranja
vulcano
[17:45] Libelula{Paciente �e nota que sabes mucho de esto Oso{Naranja! Tu respuesta "vulcano" es correcta y ganas �5660�12 puntos [17:45] Libelula{Paciente
�e nota que sabes mucho de esto Oso{Naranja! Tu respuesta "vulcano" es correcta y ganas �5660�12 puntos
[17:45] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:45] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:45] Libelula{Paciente Oso{Naranja has acertado 2 seguidas!! Puntos HOY: 442015, SEMANA: 442015 y MES: 442015 [17:45] Libelula{Paciente
Oso{Naranja has acertado 2 seguidas!! Puntos HOY: 442015, SEMANA: 442015 y MES: 442015
[17:45] Oso{Naranja XD [17:45] Oso{Naranja
XD
[17:45] Libelula{Paciente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [17:45] Libelula{Paciente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[17:45] Libelula{Paciente Tri.7286 Fisica-QuimicaɃort˿AaQuehsehdebehlardiferenciardehmasardehlostis󴯰ostdehunjelementor?a [17:45] Libelula{Paciente
Tri.7286 Fisica-QuimicaɃort˿AaQuehsehdebehlardiferenciardehmasardehlostis󴯰ostdehunjelementor?a
[17:45] Libelula{Paciente 1 Pista: ******** ****** ** ********* Valor pregunta : 24528 Puntos [17:45] Libelula{Paciente
1 Pista: ******** ****** ** ********* Valor pregunta : 24528 Puntos
[17:45] Oso{Naranja buaaa [17:45] Oso{Naranja
buaaa
[17:45] Libelula{Paciente 2 Pista: dis***** ****** ** ********* 30 segundos y 24528 Puntos [17:45] Libelula{Paciente
2 Pista: dis***** ****** ** ********* 30 segundos y 24528 Puntos
[17:46] Libelula{Paciente 3 Pista: dis*i**o *u*e*o *e *eu**o*e* 15 segundos y 24528 Puntos [17:46] Libelula{Paciente
3 Pista: dis*i**o *u*e*o *e *eu**o*e* 15 segundos y 24528 Puntos
[17:46] Oso{Naranja 15 minutos mas [17:46] Oso{Naranja
15 minutos mas
[17:46] Libelula{Paciente Tiempo! La respuesta es -> distinto�umero�e�eutrones <- [17:46] Libelula{Paciente
Tiempo! La respuesta es -> distinto�umero�e�eutrones <-
[17:46] Oso{Naranja y me retiro [17:46] Oso{Naranja
y me retiro
[17:46] Libelula{Paciente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [17:46] Libelula{Paciente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[17:46] Libelula{Paciente Tri.11043 MitologiaɁleatha˿EleprimerdfaraonvdelereinoddeleNiloderanhijoddeaZeusyea...x?x [17:46] Libelula{Paciente
Tri.11043 MitologiaɁleatha˿EleprimerdfaraonvdelereinoddeleNiloderanhijoddeaZeusyea...x?x
[17:46] Libelula{Paciente 1 Pista: ** Valor pregunta : 5213 Puntos [17:46] Libelula{Paciente
1 Pista: ** Valor pregunta : 5213 Puntos
[17:46] Cocodrilo\Suave por qué [17:46] Cocodrilo\Suave
por qué
[17:46] Oso{Naranja por que tengo cosas que hacer [17:46] Oso{Naranja
por que tengo cosas que hacer
[17:46] Libelula{Paciente 2 Pista: io 30 segundos y 5213 Puntos [17:46] Libelula{Paciente
2 Pista: io 30 segundos y 5213 Puntos
[17:46] Oso{Naranja io [17:46] Oso{Naranja
io
[17:46] Libelula{Paciente �Oso{Naranja acert󡡠La respuesta era: "io" y contest󠥮 �8.39 segundos. Se lleva: �213�12 puntos [17:46] Libelula{Paciente
�Oso{Naranja acert󡡠La respuesta era: "io" y contest󠥮 �8.39 segundos. Se lleva: �213�12 puntos
[17:46] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:46] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:46] Libelula{Paciente Oso{Naranja has acertado 3 seguidas!! Puntos HOY: 447228, SEMANA: 447228 y MES: 447228 [17:46] Libelula{Paciente
Oso{Naranja has acertado 3 seguidas!! Puntos HOY: 447228, SEMANA: 447228 y MES: 447228
[17:46] Oso{Naranja jajaja [17:46] Oso{Naranja
jajaja
[17:46] Libelula{Paciente R᮫ing SEMANA: - #1: Cocodrilo\Suave 7865377 #2: {FoSFoRiTa} 5002753 #3: Karen 3690094 #4: Alii 1994438 #5: Danielitto 1424982 #6: Ketzy 1150014 #7: NN_vOx-14_Lagrimas-Progres 981673 #8: Cobaya{Letal 734344 #9: Grillo}Respetable 498416 #10: Oso{Naranja 447228 [17:46] Libelula{Paciente
R᮫ing SEMANA: - #1: Cocodrilo\Suave 7865377 #2: {FoSFoRiTa} 5002753 #3: Karen 3690094 #4: Alii 1994438 #5: Danielitto 1424982 #6: Ketzy 1150014 #7: NN_vOx-14_Lagrimas-Progres 981673 #8: Cobaya{Letal 734344 #9: Grillo}Respetable 498416 #10: Oso{Naranja 447228
[17:46] Libelula{Paciente Tri.8748 CineɁcuarios˿COMOfSEfLLAMAfELfPAISfDEfLAfHEROICAfDIOSAfGUERRERAfTEELAfENfMASTERSfDELfUNIVERSOf?f [17:46] Libelula{Paciente
Tri.8748 CineɁcuarios˿COMOfSEfLLAMAfELfPAISfDEfLAfHEROICAfDIOSAfGUERRERAfTEELAfENfMASTERSfDELfUNIVERSOf?f
[17:46] Libelula{Paciente 1 Pista: ******* Pregunta de BONUS : 100000 Puntos [17:46] Libelula{Paciente
1 Pista: ******* Pregunta de BONUS : 100000 Puntos
[17:47] Oso{Naranja minerva [17:47] Oso{Naranja
minerva
[17:47] Libelula{Paciente 2 Pista: ete**** 30 segundos y 100000 Puntos [17:47] Libelula{Paciente
2 Pista: ete**** 30 segundos y 100000 Puntos
[17:47] Oso{Naranja atenea [17:47] Oso{Naranja
atenea
[17:47] Oso{Naranja eterniti [17:47] Oso{Naranja
eterniti
[17:47] Libelula{Paciente 3 Pista: ete**ia 15 segundos y 100000 Puntos [17:47] Libelula{Paciente
3 Pista: ete**ia 15 segundos y 100000 Puntos
[17:47] Cocodrilo\Suave etercia [17:47] Cocodrilo\Suave
etercia
[17:47] Oso{Naranja eternia [17:47] Oso{Naranja
eternia
[17:47] Libelula{Paciente �Suma y sigue Oso{Naranja!! La respuesta: "eternia" incrementa tu marcador en �00000�12 puntos [17:47] Libelula{Paciente
�Suma y sigue Oso{Naranja!! La respuesta: "eternia" incrementa tu marcador en �00000�12 puntos
[17:47] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:47] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:47] Libelula{Paciente Oso{Naranja has acertado 4 seguidas!! Puntos HOY: 547228, SEMANA: 547228 y MES: 547228 [17:47] Libelula{Paciente
Oso{Naranja has acertado 4 seguidas!! Puntos HOY: 547228, SEMANA: 547228 y MES: 547228
[17:47] Cocodrilo\Suave eterria [17:47] Cocodrilo\Suave
eterria
[17:47] Libelula{Paciente We feature over 50,000 Q&A ! [17:47] Libelula{Paciente
We feature over 50,000 Q&A !
[17:47] Libelula{Paciente Tri.61 DeporteɔeLaRaNhA˿CuantasaSupercopasadebEspa񡃰1etienebelpAtl鴩condebMadrid,qenvcifrae(updatede2002)?q?q [17:47] Libelula{Paciente
Tri.61 DeporteɔeLaRaNhA˿CuantasaSupercopasadebEspa񡃰1etienebelpAtl鴩condebMadrid,qenvcifrae(updatede2002)?q?q
[17:47] Libelula{Paciente 1 Pista: * Valor pregunta : 23708 Puntos [17:47] Libelula{Paciente
1 Pista: * Valor pregunta : 23708 Puntos
[17:48] Oso{Naranja 0 [17:48] Oso{Naranja
0
[17:48] Oso{Naranja 1 [17:48] Oso{Naranja
1
[17:48] Libelula{Paciente 2 Pista: 1 30 segundos y 23708 Puntos [17:48] Libelula{Paciente
2 Pista: 1 30 segundos y 23708 Puntos
[17:48] Libelula{Paciente �Ol頃04Oso{Naranja!! Has contestado: "1" en �5.344 segundos y sumas �3708�12 puntos a tu marcador. �Sigue as� [17:48] Libelula{Paciente
�Ol頃04Oso{Naranja!! Has contestado: "1" en �5.344 segundos y sumas �3708�12 puntos a tu marcador. �Sigue as�
[17:48] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:48] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:48] Libelula{Paciente Oso{Naranja has acertado 5 seguidas!! Puntos HOY: 570936, SEMANA: 570936 y MES: 570936 [17:48] Libelula{Paciente
Oso{Naranja has acertado 5 seguidas!! Puntos HOY: 570936, SEMANA: 570936 y MES: 570936
[17:48] Cocodrilo\Suave 2 [17:48] Cocodrilo\Suave
2
[17:48] Cocodrilo\Suave 3 [17:48] Cocodrilo\Suave
3
[17:48] Libelula{Paciente Tri.150 Musicaɴjmm.com˿Detcu᮴osdinstrumentosdconstalelsestandarlGeneralsMIDI?x?x [17:48] Libelula{Paciente
Tri.150 Musicaɴjmm.com˿Detcu᮴osdinstrumentosdconstalelsestandarlGeneralsMIDI?x?x
[17:48] Libelula{Paciente 1 Pista: *** Valor pregunta : 20635 Puntos [17:48] Libelula{Paciente
1 Pista: *** Valor pregunta : 20635 Puntos
[17:48] Oso{Naranja 4 [17:48] Oso{Naranja
4
[17:48] Oso{Naranja 5 [17:48] Oso{Naranja
5
[17:48] Oso{Naranja 6 [17:48] Oso{Naranja
6
[17:48] Oso{Naranja 7 [17:48] Oso{Naranja
7
[17:48] Oso{Naranja dos [17:48] Oso{Naranja
dos
[17:48] Oso{Naranja uno [17:48] Oso{Naranja
uno
[17:48] Libelula{Paciente 2 Pista: 128 30 segundos y 20635 Puntos [17:48] Libelula{Paciente
2 Pista: 128 30 segundos y 20635 Puntos
[17:48] Libelula{Paciente �e nota que sabes mucho de esto Oso{Naranja! Tu respuesta "128" es correcta y ganas �0635�12 puntos [17:48] Libelula{Paciente
�e nota que sabes mucho de esto Oso{Naranja! Tu respuesta "128" es correcta y ganas �0635�12 puntos
[17:48] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:48] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:48] Libelula{Paciente Oso{Naranja has acertado 6 seguidas!! Puntos HOY: 591571, SEMANA: 591571 y MES: 591571 [17:48] Libelula{Paciente
Oso{Naranja has acertado 6 seguidas!! Puntos HOY: 591571, SEMANA: 591571 y MES: 591571
[17:48] Oso{Naranja 128 [17:48] Oso{Naranja
128
[17:48] Oso{Naranja XD [17:48] Oso{Naranja
XD
[17:48] Libelula{Paciente Tri.13714 Medicina-Saludɂatval˿CUALqESqELqMUSCULOqMASqFUERTE?q?q [17:48] Libelula{Paciente
Tri.13714 Medicina-Saludɂatval˿CUALqESqELqMUSCULOqMASqFUERTE?q?q
[17:48] Libelula{Paciente 1 Pista: ******** Valor pregunta : 21492 Puntos [17:48] Libelula{Paciente
1 Pista: ******** Valor pregunta : 21492 Puntos
[17:48] Oso{Naranja hercules [17:48] Oso{Naranja
hercules
[17:48] Oso{Naranja jaja [17:48] Oso{Naranja
jaja
[17:48] Libelula{Paciente 2 Pista: mas***** 30 segundos y 21492 Puntos [17:48] Libelula{Paciente
2 Pista: mas***** 30 segundos y 21492 Puntos
[17:49] Oso{Naranja masiste [17:49] Oso{Naranja
masiste
[17:49] Cocodrilo\Suave masetero [17:49] Cocodrilo\Suave
masetero
[17:49] Libelula{Paciente �Absolutamente correcto Cocodrilo\Suave!! Acertaste "masetero" en �7.016 segundos y ganas �1492�12 puntos [17:49] Libelula{Paciente
�Absolutamente correcto Cocodrilo\Suave!! Acertaste "masetero" en �7.016 segundos y ganas �1492�12 puntos
[17:49] Libelula{Paciente ACTION awards Cocodrilo\Suave with a +v for having over 15000 points [17:49] Libelula{Paciente
ACTION awards Cocodrilo\Suave with a +v for having over 15000 points
[17:49] Libelula{Paciente Cocodrilo\Suave has acertado 1 seguidas!! Puntos HOY: 1043908, SEMANA: 7886869 y MES: 15113113 [17:49] Libelula{Paciente
Cocodrilo\Suave has acertado 1 seguidas!! Puntos HOY: 1043908, SEMANA: 7886869 y MES: 15113113
[17:49] Libelula{Paciente Please remember this is a FREE service, Please do not complain [17:49] Libelula{Paciente
Please remember this is a FREE service, Please do not complain
[17:49] Libelula{Paciente Tri.16621 Medicina-Saludɲateta˿Comozseuadministrasunjmedicamentozcuandozdiceu"pornviasparenteral"x?x [17:49] Libelula{Paciente
Tri.16621 Medicina-Saludɲateta˿Comozseuadministrasunjmedicamentozcuandozdiceu"pornviasparenteral"x?x
[17:49] Libelula{Paciente 1 Pista: *** ********* Valor pregunta : 17663 Puntos [17:49] Libelula{Paciente
1 Pista: *** ********* Valor pregunta : 17663 Puntos
[17:49] Oso{Naranja por ... [17:49] Oso{Naranja
por ...
[17:49] Libelula{Paciente 2 Pista: por ********* 30 segundos y 17663 Puntos [17:49] Libelula{Paciente
2 Pista: por ********* 30 segundos y 17663 Puntos
[17:49] Libelula{Paciente �Muy bien Cocodrilo\Suave!! Acertaste "por inyeccion" en tan s󬯠�3.906 segundos y por eso has ganado: �7663�12 puntos [17:49] Libelula{Paciente
�Muy bien Cocodrilo\Suave!! Acertaste "por inyeccion" en tan s󬯠�3.906 segundos y por eso has ganado: �7663�12 puntos
[17:49] Libelula{Paciente ACTION awards Cocodrilo\Suave with a +v for having over 15000 points [17:49] Libelula{Paciente
ACTION awards Cocodrilo\Suave with a +v for having over 15000 points
[17:49] Libelula{Paciente Cocodrilo\Suave has acertado 2 seguidas!! Puntos HOY: 1061571, SEMANA: 7904532 y MES: 15130776 [17:49] Libelula{Paciente
Cocodrilo\Suave has acertado 2 seguidas!! Puntos HOY: 1061571, SEMANA: 7904532 y MES: 15130776
[17:49] Cocodrilo\Suave por inyeccion [17:49] Cocodrilo\Suave
por inyeccion
[17:49] Libelula{Paciente R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: {FoSFoRiTa} 30927547 #4: Grillo}Respetable 16843241 #5: Karen 14172663 [17:49] Libelula{Paciente
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: {FoSFoRiTa} 30927547 #4: Grillo}Respetable 16843241 #5: Karen 14172663
[17:49] Libelula{Paciente Tri.20894 MiscelaneaɍARdeJAVA˖IDEOJUEGOS:z߃ӍOzSEzLLAMAzELzPEQUEяzDINOSAURIOzQUEzACOMPAсzAzSUPERzMARIOzENzMUCHASzDEzSUSzAVENTURAS?z?z [17:49] Libelula{Paciente
Tri.20894 MiscelaneaɍARdeJAVA˖IDEOJUEGOS:z߃ӍOzSEzLLAMAzELzPEQUEяzDINOSAURIOzQUEzACOMPAсzAzSUPERzMARIOzENzMUCHASzDEzSUSzAVENTURAS?z?z
[17:49] Libelula{Paciente 1 Pista: ***** Valor pregunta : 21348 Puntos [17:49] Libelula{Paciente
1 Pista: ***** Valor pregunta : 21348 Puntos
[17:50] Oso{Naranja dumbo [17:50] Oso{Naranja
dumbo
[17:50] Oso{Naranja XD [17:50] Oso{Naranja
XD
[17:50] Libelula{Paciente 2 Pista: yos** 30 segundos y 21348 Puntos [17:50] Libelula{Paciente
2 Pista: yos** 30 segundos y 21348 Puntos
[17:50] Libelula{Paciente �Eso es Cocodrilo\Suave!! Dijiste: "yoshi" y ello te ha valido: �1348�12 puntos [17:50] Libelula{Paciente
�Eso es Cocodrilo\Suave!! Dijiste: "yoshi" y ello te ha valido: �1348�12 puntos
[17:50] Libelula{Paciente ACTION awards Cocodrilo\Suave with a +v for having over 15000 points [17:50] Libelula{Paciente
ACTION awards Cocodrilo\Suave with a +v for having over 15000 points
[17:50] Libelula{Paciente Cocodrilo\Suave has acertado 3 seguidas!! Puntos HOY: 1082919, SEMANA: 7925880 y MES: 15152124 [17:50] Libelula{Paciente
Cocodrilo\Suave has acertado 3 seguidas!! Puntos HOY: 1082919, SEMANA: 7925880 y MES: 15152124
[17:50] Cocodrilo\Suave yoshi [17:50] Cocodrilo\Suave
yoshi
[17:50] Oso{Naranja yossi [17:50] Oso{Naranja
yossi
[17:50] Libelula{Paciente If you think a Q&A is wrong, please call an OP [17:50] Libelula{Paciente
If you think a Q&A is wrong, please call an OP
[17:50] Libelula{Paciente Tri.12374 Deporteɴjmm.comˇanadorjdelmTourjdevFranciat2004.y?y [17:50] Libelula{Paciente
Tri.12374 Deporteɴjmm.comˇanadorjdelmTourjdevFranciat2004.y?y
[17:50] Libelula{Paciente 1 Pista: ***** ********* Valor pregunta : 8657 Puntos [17:50] Libelula{Paciente
1 Pista: ***** ********* Valor pregunta : 8657 Puntos
[17:50] Oso{Naranja paso [17:50] Oso{Naranja
paso
[17:50] Libelula{Paciente 2 Pista: lan** ********* 30 segundos y 8657 Puntos [17:50] Libelula{Paciente
2 Pista: lan** ********* 30 segundos y 8657 Puntos
[17:50] Cocodrilo\Suave lance armstrong [17:50] Cocodrilo\Suave
lance armstrong
[17:50] Libelula{Paciente �As�e hace Cocodrilo\Suave!! Contestaste "lance armstrong" en �9.516 segundos y sumas �657�12 puntos [17:50] Libelula{Paciente
�As�e hace Cocodrilo\Suave!! Contestaste "lance armstrong" en �9.516 segundos y sumas �657�12 puntos
[17:50] Libelula{Paciente ACTION awards Cocodrilo\Suave with a +v for having over 15000 points [17:50] Libelula{Paciente
ACTION awards Cocodrilo\Suave with a +v for having over 15000 points
[17:50] Libelula{Paciente Cocodrilo\Suave has acertado 4 seguidas!! Puntos HOY: 1091576, SEMANA: 7934537 y MES: 15160781 [17:50] Libelula{Paciente
Cocodrilo\Suave has acertado 4 seguidas!! Puntos HOY: 1091576, SEMANA: 7934537 y MES: 15160781
[17:50] Libelula{Paciente R᮫ing por D́: - Domingo: Ketzy 1150014 Lunes: Karen 1245745 Martes: {FoSFoRiTa} 388010 Miercoles: Cocodrilo\Suave 2638625 Jueves: Karen 824895 Viernes: Cocodrilo\Suave 2430737 Sᢡdo: welcome3 3286708 [17:50] Libelula{Paciente
R᮫ing por D́: - Domingo: Ketzy 1150014 Lunes: Karen 1245745 Martes: {FoSFoRiTa} 388010 Miercoles: Cocodrilo\Suave 2638625 Jueves: Karen 824895 Viernes: Cocodrilo\Suave 2430737 Sᢡdo: welcome3 3286708
[17:50] Libelula{Paciente Tri.13581 Musicaɔorero˿Deuqui鮃01yeslelwᬢumd"Rainbow"m?m [17:50] Libelula{Paciente
Tri.13581 Musicaɔorero˿Deuqui鮃01yeslelwᬢumd"Rainbow"m?m
[17:50] Libelula{Paciente 1 Pista: ****** ***** Pregunta de BONUS : 50000 Puntos [17:50] Libelula{Paciente
1 Pista: ****** ***** Pregunta de BONUS : 50000 Puntos
[17:51] Libelula{Paciente 2 Pista: mar*** ***** 30 segundos y 50000 Puntos [17:51] Libelula{Paciente
2 Pista: mar*** ***** 30 segundos y 50000 Puntos
[17:51] Oso{Naranja de quien será [17:51] Oso{Naranja
de quien será
[17:51] Libelula{Paciente 3 Pista: maria* *a*e* 15 segundos y 50000 Puntos [17:51] Libelula{Paciente
3 Pista: maria* *a*e* 15 segundos y 50000 Puntos
[17:51] Libelula{Paciente Tiempo! La respuesta es -> mariah�arey <- [17:51] Libelula{Paciente
Tiempo! La respuesta es -> mariah�arey <-
[17:51] Libelula{Paciente For The Competitive Edge type !pingme [17:51] Libelula{Paciente
For The Competitive Edge type !pingme
[17:51] Libelula{Paciente Tri.7276 Fisica-Quimicaɤannae˿Comosseqllamailaidisoluci󮃰1xqueqnosadmiteqm᳃01ysolutos?z [17:51] Libelula{Paciente
Tri.7276 Fisica-Quimicaɤannae˿Comosseqllamailaidisoluci󮃰1xqueqnosadmiteqm᳃01ysolutos?z
[17:51] Libelula{Paciente 1 Pista: ********** ******** Valor pregunta : 16024 Puntos [17:51] Libelula{Paciente
1 Pista: ********** ******** Valor pregunta : 16024 Puntos
[17:51] Cocodrilo\Suave mejor me voy me van a embarazar y no voy a saber de uien fue [17:51] Cocodrilo\Suave
mejor me voy me van a embarazar y no voy a saber de uien fue
[17:52] Libelula{Paciente 2 Pista: dis******* ******** 30 segundos y 16024 Puntos [17:52] Libelula{Paciente
2 Pista: dis******* ******** 30 segundos y 16024 Puntos
[17:52] Oso{Naranja :O [17:52] Oso{Naranja
:O
[17:52] Libelula{Paciente 3 Pista: diso*u*io* *a*u*a*a 15 segundos y 16024 Puntos [17:52] Libelula{Paciente
3 Pista: diso*u*io* *a*u*a*a 15 segundos y 16024 Puntos
[17:52] Grillo}Respetable jajajajajajajajaja [17:52] Grillo}Respetable
jajajajajajajajaja
[17:52] Cocodrilo\Suave disolucion saturada [17:52] Cocodrilo\Suave
disolucion saturada
[17:52] Libelula{Paciente �Suma y sigue Cocodrilo\Suave!! La respuesta: "disolucion saturada" incrementa tu marcador en �6024�12 puntos [17:52] Libelula{Paciente
�Suma y sigue Cocodrilo\Suave!! La respuesta: "disolucion saturada" incrementa tu marcador en �6024�12 puntos
[17:52] Libelula{Paciente ACTION awards Cocodrilo\Suave with a +v for having over 15000 points [17:52] Libelula{Paciente
ACTION awards Cocodrilo\Suave with a +v for having over 15000 points
[17:52] Libelula{Paciente Cocodrilo\Suave has acertado 5 seguidas!! Puntos HOY: 1107600, SEMANA: 7950561 y MES: 15176805 [17:52] Libelula{Paciente
Cocodrilo\Suave has acertado 5 seguidas!! Puntos HOY: 1107600, SEMANA: 7950561 y MES: 15176805
[17:52] Libelula{Paciente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [17:52] Libelula{Paciente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[17:52] Libelula{Paciente Tri.19792 CienciaɔeLaRaNhA˿Lafmezclafdeuoxigeno,mnitrogenohyeheliohseudenomina...m?m [17:52] Libelula{Paciente
Tri.19792 CienciaɔeLaRaNhA˿Lafmezclafdeuoxigeno,mnitrogenohyeheliohseudenomina...m?m
[17:52] Libelula{Paciente 1 Pista: ****** Valor pregunta : 10198 Puntos [17:52] Libelula{Paciente
1 Pista: ****** Valor pregunta : 10198 Puntos
[17:52] Oso{Naranja mezcla [17:52] Oso{Naranja
mezcla
[17:52] Cocodrilo\Suave trimix [17:52] Cocodrilo\Suave
trimix
[17:52] Libelula{Paciente �Ol頃04Cocodrilo\Suave!! Has contestado: "trimix" en �3.187 segundos y sumas �0198�12 puntos a tu marcador. �Sigue as� [17:52] Libelula{Paciente
�Ol頃04Cocodrilo\Suave!! Has contestado: "trimix" en �3.187 segundos y sumas �0198�12 puntos a tu marcador. �Sigue as�
[17:52] Libelula{Paciente ACTION awards Cocodrilo\Suave with a +v for having over 15000 points [17:52] Libelula{Paciente
ACTION awards Cocodrilo\Suave with a +v for having over 15000 points
[17:52] Libelula{Paciente Cocodrilo\Suave has acertado 6 seguidas!! Puntos HOY: 1117798, SEMANA: 7960759 y MES: 15187003 [17:52] Libelula{Paciente
Cocodrilo\Suave has acertado 6 seguidas!! Puntos HOY: 1117798, SEMANA: 7960759 y MES: 15187003
[17:53] Libelula{Paciente R᮫ing MES: - #1: welcome3 21243832 #2: Cocodrilo\Suave 15176805 #3: Danielitto 10886756 #4: Karen 9086159 #5: {FoSFoRiTa} 7343057 #6: Alii 5900389 #7: Grillo}Respetable 4163643 #8: Ketzy 1150014 #9: NN_vOx-14_Lagrimas-Progres 981673 #10: NN_vOx_Bukelizacion-YA 839312 [17:53] Libelula{Paciente
R᮫ing MES: - #1: welcome3 21243832 #2: Cocodrilo\Suave 15176805 #3: Danielitto 10886756 #4: Karen 9086159 #5: {FoSFoRiTa} 7343057 #6: Alii 5900389 #7: Grillo}Respetable 4163643 #8: Ketzy 1150014 #9: NN_vOx-14_Lagrimas-Progres 981673 #10: NN_vOx_Bukelizacion-YA 839312
[17:53] Libelula{Paciente Tri.16176 MiscelaneaɔeLaRaNhA˿Elkbiennvienekandandob?w [17:53] Libelula{Paciente
Tri.16176 MiscelaneaɔeLaRaNhA˿Elkbiennvienekandandob?w
[17:53] Libelula{Paciente 1 Pista: **** ** *** ******* Valor pregunta : 7665 Puntos [17:53] Libelula{Paciente
1 Pista: **** ** *** ******* Valor pregunta : 7665 Puntos
[17:53] Libelula{Paciente 2 Pista: per* ** *** ******* 30 segundos y 7665 Puntos [17:53] Libelula{Paciente
2 Pista: per* ** *** ******* 30 segundos y 7665 Puntos
[17:53] Cocodrilo\Suave pero el mal volando [17:53] Cocodrilo\Suave
pero el mal volando
[17:53] Libelula{Paciente �Increible!! Cocodrilo\Suave contest󺠃04"pero el mal volando" en �9.406 segundos, y ha ganado �665�12 puntos [17:53] Libelula{Paciente
�Increible!! Cocodrilo\Suave contest󺠃04"pero el mal volando" en �9.406 segundos, y ha ganado �665�12 puntos
[17:53] Libelula{Paciente ACTION awards Cocodrilo\Suave with a +v for having over 15000 points [17:53] Libelula{Paciente
ACTION awards Cocodrilo\Suave with a +v for having over 15000 points
[17:53] Libelula{Paciente Cocodrilo\Suave has acertado 7 seguidas!! Puntos HOY: 1125463, SEMANA: 7968424 y MES: 15194668 [17:53] Libelula{Paciente
Cocodrilo\Suave has acertado 7 seguidas!! Puntos HOY: 1125463, SEMANA: 7968424 y MES: 15194668
[17:53] Libelula{Paciente Please refrain from using Extreme Bad Language [17:53] Libelula{Paciente
Please refrain from using Extreme Bad Language
[17:53] Libelula{Paciente Tri.11176 Economiaɦlipp_er˿Cualiesdelipaisdmayorkproductorkdenvinozdelimundo?c?c [17:53] Libelula{Paciente
Tri.11176 Economiaɦlipp_er˿Cualiesdelipaisdmayorkproductorkdenvinozdelimundo?c?c
[17:53] Libelula{Paciente 1 Pista: ****** Valor pregunta : 14557 Puntos [17:53] Libelula{Paciente
1 Pista: ****** Valor pregunta : 14557 Puntos
[17:53] Oso{Naranja españa [17:53] Oso{Naranja
españa
[17:53] Libelula{Paciente �emuestra lo que sabes Oso{Naranja! Has respondido "italia" correctamente y eso te da: �4557�12 puntos [17:53] Libelula{Paciente
�emuestra lo que sabes Oso{Naranja! Has respondido "italia" correctamente y eso te da: �4557�12 puntos
[17:53] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:53] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:53] Libelula{Paciente Oso{Naranja has acertado 1 seguidas!! Puntos HOY: 606128, SEMANA: 606128 y MES: 606128 [17:53] Libelula{Paciente
Oso{Naranja has acertado 1 seguidas!! Puntos HOY: 606128, SEMANA: 606128 y MES: 606128
[17:53] Oso{Naranja italia [17:53] Oso{Naranja
italia
[17:54] Libelula{Paciente This is #Mexico, I am your host Libelula{Paciente, running Libelula{Paciente [17:54] Libelula{Paciente
This is #Mexico, I am your host Libelula{Paciente, running Libelula{Paciente
[17:54] Libelula{Paciente Tri.4982 ArteɐEDROC˿CAPILLApPRINCIPALpDELpPALACIOpVATICANO?p?p [17:54] Libelula{Paciente
Tri.4982 ArteɐEDROC˿CAPILLApPRINCIPALpDELpPALACIOpVATICANO?p?p
[17:54] Libelula{Paciente 1 Pista: ******* ******* Valor pregunta : 13131 Puntos [17:54] Libelula{Paciente
1 Pista: ******* ******* Valor pregunta : 13131 Puntos
[17:54] Libelula{Paciente 2 Pista: cap**** ******* 30 segundos y 13131 Puntos [17:54] Libelula{Paciente
2 Pista: cap**** ******* 30 segundos y 13131 Puntos
[17:54] Oso{Naranja capilla sixtina [17:54] Oso{Naranja
capilla sixtina
[17:54] Libelula{Paciente �As�e hace Oso{Naranja!! Contestaste "capilla sixtina" en �2.89 segundos y sumas �3131�12 puntos [17:54] Libelula{Paciente
�As�e hace Oso{Naranja!! Contestaste "capilla sixtina" en �2.89 segundos y sumas �3131�12 puntos
[17:54] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:54] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:54] Libelula{Paciente Oso{Naranja has acertado 2 seguidas!! Puntos HOY: 619259, SEMANA: 619259 y MES: 619259 [17:54] Libelula{Paciente
Oso{Naranja has acertado 2 seguidas!! Puntos HOY: 619259, SEMANA: 619259 y MES: 619259
[17:54] Libelula{Paciente This WEEKS Top 11-20: - #11: Unheimlich 343574 #12: HeaLth_Rider 267851 #13: wilby 87595 #14: Cobaya{Letal12 85108 #15: welcome3 74396 #16: joooooovencito_67 54103 #17: Elefante{Humilde 44016 #18: RuBeN_Mty- 39820 #19: cubanito 31826 #20: LeCaTwaLk_z 25000 [17:54] Libelula{Paciente
This WEEKS Top 11-20: - #11: Unheimlich 343574 #12: HeaLth_Rider 267851 #13: wilby 87595 #14: Cobaya{Letal12 85108 #15: welcome3 74396 #16: joooooovencito_67 54103 #17: Elefante{Humilde 44016 #18: RuBeN_Mty- 39820 #19: cubanito 31826 #20: LeCaTwaLk_z 25000
[17:54] Libelula{Paciente Tri.12532 Miscelaneaɓebosin˿CUALsSOBRA?(PISTA:sHayz4s�tilesedelpintormyzunxinstrumentozdelagricultura)sLienzo,scaballete,sleg󮬃01sespᴵla,spaleta?s?s [17:54] Libelula{Paciente
Tri.12532 Miscelaneaɓebosin˿CUALsSOBRA?(PISTA:sHayz4s�tilesedelpintormyzunxinstrumentozdelagricultura)sLienzo,scaballete,sleg󮬃01sespᴵla,spaleta?s?s
[17:54] Libelula{Paciente 1 Pista: ***** Valor pregunta : 11850 Puntos [17:54] Libelula{Paciente
1 Pista: ***** Valor pregunta : 11850 Puntos
[17:54] Oso{Naranja lienzo [17:54] Oso{Naranja
lienzo
[17:54] Libelula{Paciente 2 Pista: leg** 30 segundos y 11850 Puntos [17:54] Libelula{Paciente
2 Pista: leg** 30 segundos y 11850 Puntos
[17:54] Cocodrilo\Suave chao Oso{Naranja   un abrazo desde la ejania [17:54] Cocodrilo\Suave
chao Oso{Naranja   un abrazo desde la ejania
[17:55] Oso{Naranja Cocodrilo\Suave   suerte que te vaya bien [17:55] Oso{Naranja
Cocodrilo\Suave   suerte que te vaya bien
[17:55] Libelula{Paciente 3 Pista: lego* 15 segundos y 11850 Puntos [17:55] Libelula{Paciente
3 Pista: lego* 15 segundos y 11850 Puntos
[17:55] Oso{Naranja a  i me quedan 5 minutos [17:55] Oso{Naranja
a  i me quedan 5 minutos
[17:55] Libelula{Paciente Tiempo! La respuesta es -> legon <- [17:55] Libelula{Paciente
Tiempo! La respuesta es -> legon <-
[17:55] Libelula{Paciente Please remember this is a FREE service, Please do not complain [17:55] Libelula{Paciente
Please remember this is a FREE service, Please do not complain
[17:55] Libelula{Paciente Tri.1159 HistoriaɊAVEA˿10xDExAGOSTOx1910:xQUExPROFESIONxMODERNIZOxLAxRECIENTExFALLECIDAxFLORENCExNIGHTINGALEx?x [17:55] Libelula{Paciente
Tri.1159 HistoriaɊAVEA˿10xDExAGOSTOx1910:xQUExPROFESIONxMODERNIZOxLAxRECIENTExFALLECIDAxFLORENCExNIGHTINGALEx?x
[17:55] Libelula{Paciente 1 Pista: ********* Pregunta de BONUS : 25000 Puntos [17:55] Libelula{Paciente
1 Pista: ********* Pregunta de BONUS : 25000 Puntos
[17:55] Libelula{Paciente 2 Pista: ENF****** 30 segundos y 25000 Puntos [17:55] Libelula{Paciente
2 Pista: ENF****** 30 segundos y 25000 Puntos
[17:55] Oso{Naranja enfermeria [17:55] Oso{Naranja
enfermeria
[17:55] Libelula{Paciente 3 Pista: ENFE**E*A 15 segundos y 25000 Puntos [17:55] Libelula{Paciente
3 Pista: ENFE**E*A 15 segundos y 25000 Puntos
[17:56] Oso{Naranja enfermera [17:56] Oso{Naranja
enfermera
[17:56] Libelula{Paciente �Bingo!! Oso{Naranja dio la respuesta: "enfermera" en �1.813 segundos e incrementa sus ganancias con �5000�12 puntos [17:56] Libelula{Paciente
�Bingo!! Oso{Naranja dio la respuesta: "enfermera" en �1.813 segundos e incrementa sus ganancias con �5000�12 puntos
[17:56] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:56] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:56] Libelula{Paciente Oso{Naranja has acertado 3 seguidas!! Puntos HOY: 644259, SEMANA: 644259 y MES: 644259 [17:56] Libelula{Paciente
Oso{Naranja has acertado 3 seguidas!! Puntos HOY: 644259, SEMANA: 644259 y MES: 644259
[17:56] Libelula{Paciente This MONTHS Top 11-20: - #11: Cobaya{Letal 734344 #12: Oso{Naranja 606128 #13: NN_vOx_Infierno-Fiscal 407404 #14: Unheimlich 343574 #15: kitana_- 299678 #16: Guerrero08 297002 #17: HeaLth_Rider 289123 #18: KaZuMa_KiRyU 258500 #19: apolomx 201118 #20: Sirena__ 184577 [17:56] Libelula{Paciente
This MONTHS Top 11-20: - #11: Cobaya{Letal 734344 #12: Oso{Naranja 606128 #13: NN_vOx_Infierno-Fiscal 407404 #14: Unheimlich 343574 #15: kitana_- 299678 #16: Guerrero08 297002 #17: HeaLth_Rider 289123 #18: KaZuMa_KiRyU 258500 #19: apolomx 201118 #20: Sirena__ 184577
[17:56] Libelula{Paciente Tri.4327 GeografiaɍARdeJAVA˿AgQUɃ01gCIUDADgSUDAMERICANAgSEgLEgHAgLLAMADOgLAgATENASgDEgAMɒICA?g?g [17:56] Libelula{Paciente
Tri.4327 GeografiaɍARdeJAVA˿AgQUɃ01gCIUDADgSUDAMERICANAgSEgLEgHAgLLAMADOgLAgATENASgDEgAMɒICA?g?g
[17:56] Libelula{Paciente 1 Pista: ****** Valor pregunta : 22948 Puntos [17:56] Libelula{Paciente
1 Pista: ****** Valor pregunta : 22948 Puntos
[17:56] Oso{Naranja bogota [17:56] Oso{Naranja
bogota
[17:56] Libelula{Paciente �e nota que sabes mucho de esto Oso{Naranja! Tu respuesta "bogota" es correcta y ganas �2948�12 puntos [17:56] Libelula{Paciente
�e nota que sabes mucho de esto Oso{Naranja! Tu respuesta "bogota" es correcta y ganas �2948�12 puntos
[17:56] Libelula{Paciente ACTION awards Oso{Naranja with a +v for having over 15000 points [17:56] Libelula{Paciente
ACTION awards Oso{Naranja with a +v for having over 15000 points
[17:56] Libelula{Paciente Oso{Naranja has acertado 4 seguidas!! Puntos HOY: 667207, SEMANA: 667207 y MES: 667207 [17:56] Libelula{Paciente
Oso{Naranja has acertado 4 seguidas!! Puntos HOY: 667207, SEMANA: 667207 y MES: 667207
[17:56] Libelula{Paciente R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: Cocodrilo\Suave 7226244 [17:56] Libelula{Paciente
R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: Cocodrilo\Suave 7226244
[17:56] Libelula{Paciente Tri.8801 Deporteɬobezno˨formulay1)eenmloswaleroneswtraseroswdelloswbmwzponelbmwzpower,eperorquelponelenmelqcocheldelmarczgen鬃01ehaciendorreferenciayaysucnovia?e?e [17:56] Libelula{Paciente
Tri.8801 Deporteɬobezno˨formulay1)eenmloswaleroneswtraseroswdelloswbmwzponelbmwzpower,eperorquelponelenmelqcocheldelmarczgen鬃01ehaciendorreferenciayaysucnovia?e?e
[17:56] Libelula{Paciente 1 Pista: *** ***** Valor pregunta : 8624 Puntos [17:56] Libelula{Paciente
1 Pista: *** ***** Valor pregunta : 8624 Puntos
[17:56] Oso{Naranja que preguntas [17:56] Oso{Naranja
que preguntas
[17:56] Libelula{Paciente 2 Pista: eva ***** 30 segundos y 8624 Puntos [17:56] Libelula{Paciente
2 Pista: eva ***** 30 segundos y 8624 Puntos
[17:56] Libelula{Paciente 3 Pista: eva *o*e* 15 segundos y 8624 Puntos [17:56] Libelula{Paciente
3 Pista: eva *o*e* 15 segundos y 8624 Puntos
[17:57] Libelula{Paciente Tiempo! La respuesta es -> eva�ower <- [17:57] Libelula{Paciente
Tiempo! La respuesta es -> eva�ower <-
[17:57] Libelula{Paciente Top10 Players ( Weekly & Monthly ) are Auto-Voiced [17:57] Libelula{Paciente
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[17:57] Libelula{Paciente Tri.7061 Cienciaɳtephenwo˿Amqu郰1munidadidehmedidaktemporalgequivalenr24hm56mk4ms?m?m [17:57] Libelula{Paciente
Tri.7061 Cienciaɳtephenwo˿Amqu郰1munidadidehmedidaktemporalgequivalenr24hm56mk4ms?m?m
[17:57] Libelula{Paciente 1 Pista: *** ******* Valor pregunta : 20938 Puntos [17:57] Libelula{Paciente
1 Pista: *** ******* Valor pregunta : 20938 Puntos
[17:57] Oso{Naranja Grillo}Respetable   te dejo para que acumules puntos tranuilamente y sin presiones  XD [17:57] Oso{Naranja
Grillo}Respetable   te dejo para que acumules puntos tranuilamente y sin presiones  XD
[17:57] Libelula{Paciente 2 Pista: dia ******* 30 segundos y 20938 Puntos [17:57] Libelula{Paciente
2 Pista: dia ******* 30 segundos y 20938 Puntos
[17:57] Grillo}Respetable naaaaa [17:57] Grillo}Respetable
naaaaa
[17:57] Grillo}Respetable juego en otro lado [17:57] Grillo}Respetable
juego en otro lado
[17:57] Libelula{Paciente 3 Pista: dia *i*e*a* 15 segundos y 20938 Puntos [17:57] Libelula{Paciente
3 Pista: dia *i*e*a* 15 segundos y 20938 Puntos
[17:58] Oso{Naranja tu juegas con los pesos pesados? [17:58] Oso{Naranja
tu juegas con los pesos pesados?
[17:58] Grillo}Respetable no [17:58] Grillo}Respetable
no
[17:58] Libelula{Paciente Tiempo! La respuesta es -> dia�ideral <- [17:58] Libelula{Paciente
Tiempo! La respuesta es -> dia�ideral <-
[17:58] Grillo}Respetable juego solo [17:58] Grillo}Respetable
juego solo
[17:58] Libelula{Paciente Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [17:58] Libelula{Paciente
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[17:58] Libelula{Paciente Tri.1965 InformaticaɉRC-Domain˿BlocidekNotas:zSizCTRL+Czesucopiar,z߱uekesuCTRL+A?z?z [17:58] Libelula{Paciente
Tri.1965 InformaticaɉRC-Domain˿BlocidekNotas:zSizCTRL+Czesucopiar,z߱uekesuCTRL+A?z?z
[17:58] Libelula{Paciente 1 Pista: ***** Valor pregunta : 12892 Puntos [17:58] Libelula{Paciente
1 Pista: ***** Valor pregunta : 12892 Puntos
[17:58] Libelula{Paciente 2 Pista: abr** 30 segundos y 12892 Puntos [17:58] Libelula{Paciente
2 Pista: abr** 30 segundos y 12892 Puntos
[17:58] Grillo}Respetable he jugado con gente muy buena, si [17:58] Grillo}Respetable
he jugado con gente muy buena, si
[17:58] Grillo}Respetable pero prefiero jugar tranquilo [17:58] Grillo}Respetable
pero prefiero jugar tranquilo
[17:58] Libelula{Paciente 3 Pista: abri* 15 segundos y 12892 Puntos [17:58] Libelula{Paciente
3 Pista: abri* 15 segundos y 12892 Puntos
[17:59] Libelula{Paciente Tiempo! La respuesta es -> abrir <- [17:59] Libelula{Paciente
Tiempo! La respuesta es -> abrir <-
[17:59] Libelula{Paciente R᮫ing SEMANA: - #1: Cocodrilo\Suave 7968424 #2: {FoSFoRiTa} 5002753 #3: Karen 3690094 #4: Alii 1994438 #5: Danielitto 1424982 #6: Ketzy 1150014 #7: NN_vOx-14_Lagrimas-Progres 981673 #8: Cobaya{Letal 734344 #9: Oso{Naranja 667207 #10: Grillo}Respetable 498416 [17:59] Libelula{Paciente
R᮫ing SEMANA: - #1: Cocodrilo\Suave 7968424 #2: {FoSFoRiTa} 5002753 #3: Karen 3690094 #4: Alii 1994438 #5: Danielitto 1424982 #6: Ketzy 1150014 #7: NN_vOx-14_Lagrimas-Progres 981673 #8: Cobaya{Letal 734344 #9: Oso{Naranja 667207 #10: Grillo}Respetable 498416
[17:59] Libelula{Paciente Tri.11767 LiteraturaɍARdeJAVAˑUɃ01sAUTORsMEXICANOs(1581-1639)sESCRIBIӃ01s"sELsTEJEDORsDEsSEGOVIA".(TR�ICA)s?s [17:59] Libelula{Paciente
Tri.11767 LiteraturaɍARdeJAVAˑUɃ01sAUTORsMEXICANOs(1581-1639)sESCRIBIӃ01s"sELsTEJEDORsDEsSEGOVIA".(TR�ICA)s?s
[17:59] Libelula{Paciente 1 Pista: **** **** ** ******* Valor pregunta : 17233 Puntos [17:59] Libelula{Paciente
1 Pista: **** **** ** ******* Valor pregunta : 17233 Puntos
[17:59] Libelula{Paciente 2 Pista: jua* **** ** ******* 30 segundos y 17233 Puntos [17:59] Libelula{Paciente
2 Pista: jua* **** ** ******* 30 segundos y 17233 Puntos
[17:59] Grillo}Respetable ademas, yo mismo edito preguntas [17:59] Grillo}Respetable
ademas, yo mismo edito preguntas
[17:59] Libelula{Paciente 3 Pista: jua* *ui* *e a*a**o* 15 segundos y 17233 Puntos [17:59] Libelula{Paciente
3 Pista: jua* *ui* *e a*a**o* 15 segundos y 17233 Puntos
[17:59] Grillo}Respetable juego con ventaja [17:59] Grillo}Respetable
juego con ventaja
[18:00] Libelula{Paciente Tiempo! La respuesta es -> juan�uiz�e�larcon <- [18:00] Libelula{Paciente
Tiempo! La respuesta es -> juan�uiz�e�larcon <-
[18:00] Libelula{Paciente We feature over 50,000 Q&A ! [18:00] Libelula{Paciente
We feature over 50,000 Q&A !
[18:00] Libelula{Paciente Tri.2850 CineɔeLaRaNhA˿DirectoresndeaShrekn2j?j [18:00] Libelula{Paciente
Tri.2850 CineɔeLaRaNhA˿DirectoresndeaShrekn2j?j
[18:00] Libelula{Paciente 1 Pista: ****** ******* * ***** ****** Valor pregunta : 17554 Puntos [18:00] Libelula{Paciente
1 Pista: ****** ******* * ***** ****** Valor pregunta : 17554 Puntos
[18:00] Grillo}Respetable asi que juego solo [18:00] Grillo}Respetable
asi que juego solo
[18:00] Libelula{Paciente 2 Pista: and*** ******* * ***** ****** 30 segundos y 17554 Puntos [18:00] Libelula{Paciente
2 Pista: and*** ******* * ***** ****** 30 segundos y 17554 Puntos
[18:00] Libelula{Paciente 3 Pista: and*e* a*a**o* * *i*** *e**o* 15 segundos y 17554 Puntos [18:00] Libelula{Paciente
3 Pista: and*e* a*a**o* * *i*** *e**o* 15 segundos y 17554 Puntos
[18:00] Libelula{Paciente Tiempo! La respuesta es -> andrew�damson��icky�enson <- [18:00] Libelula{Paciente
Tiempo! La respuesta es -> andrew�damson��icky�enson <-
[18:01] Libelula{Paciente Tri.19293 Biologiaɓcullder˿LOCALIZACIoNqDEqLASqCeLULASqDEqLEYDIG?q?q [18:01] Libelula{Paciente
Tri.19293 Biologiaɓcullder˿LOCALIZACIoNqDEqLASqCeLULASqDEqLEYDIG?q?q
[18:01] Libelula{Paciente 1 Pista: ********* Valor pregunta : 15706 Puntos [18:01] Libelula{Paciente
1 Pista: ********* Valor pregunta : 15706 Puntos
[18:01] Libelula{Paciente 2 Pista: tes****** 30 segundos y 15706 Puntos [18:01] Libelula{Paciente
2 Pista: tes****** 30 segundos y 15706 Puntos
[18:01] Libelula{Paciente 3 Pista: tes*i*u*o 15 segundos y 15706 Puntos [18:01] Libelula{Paciente
3 Pista: tes*i*u*o 15 segundos y 15706 Puntos
[18:01] Libelula{Paciente Tiempo! La respuesta es -> testiculo <- [18:01] Libelula{Paciente
Tiempo! La respuesta es -> testiculo <-
[18:02] Libelula{Paciente Tri.11657 Cancionesɖivian˿Aoquejautormpertenecejeljtemax"Unfvelerojllamadojlibertad"o?o [18:02] Libelula{Paciente
Tri.11657 Cancionesɖivian˿Aoquejautormpertenecejeljtemax"Unfvelerojllamadojlibertad"o?o
[18:02] Libelula{Paciente 1 Pista: **** **** ******* Valor pregunta : 8285 Puntos [18:02] Libelula{Paciente
1 Pista: **** **** ******* Valor pregunta : 8285 Puntos
[18:02] Libelula{Paciente 2 Pista: jos* **** ******* 30 segundos y 8285 Puntos [18:02] Libelula{Paciente
2 Pista: jos* **** ******* 30 segundos y 8285 Puntos
[18:02] Libelula{Paciente 3 Pista: jose *ui* *e*a*e* 15 segundos y 8285 Puntos [18:02] Libelula{Paciente
3 Pista: jose *ui* *e*a*e* 15 segundos y 8285 Puntos
[18:02] Libelula{Paciente Tiempo! La respuesta es -> jose�uis�erales <- [18:02] Libelula{Paciente
Tiempo! La respuesta es -> jose�uis�erales <-
[18:02] Libelula{Paciente Please remember this is a FREE service, Please do not complain [18:02] Libelula{Paciente
Please remember this is a FREE service, Please do not complain
[18:02] Libelula{Paciente Tri.10922 Deporteɚytox˿CualzeslelzcircuitogdeuE.E.U.U.fdondeuseucorrenblasl500fmillasl?f [18:02] Libelula{Paciente
Tri.10922 Deporteɚytox˿CualzeslelzcircuitogdeuE.E.U.U.fdondeuseucorrenblasl500fmillasl?f
[18:02] Libelula{Paciente 1 Pista: ************ Valor pregunta : 20656 Puntos [18:02] Libelula{Paciente
1 Pista: ************ Valor pregunta : 20656 Puntos
[18:03] Libelula{Paciente 2 Pista: ind********* 30 segundos y 20656 Puntos [18:03] Libelula{Paciente
2 Pista: ind********* 30 segundos y 20656 Puntos
[18:03] Libelula{Paciente 3 Pista: india*a*o*i* 15 segundos y 20656 Puntos [18:03] Libelula{Paciente
3 Pista: india*a*o*i* 15 segundos y 20656 Puntos
[18:03] Libelula{Paciente Tiempo! La respuesta es -> indianapolis <- [18:03] Libelula{Paciente
Tiempo! La respuesta es -> indianapolis <-
[18:03] Libelula{Paciente R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: {FoSFoRiTa} 30927547 #4: Grillo}Respetable 16843241 #5: Karen 14172663 [18:03] Libelula{Paciente
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: {FoSFoRiTa} 30927547 #4: Grillo}Respetable 16843241 #5: Karen 14172663
[18:03] Libelula{Paciente Tri.15744 GastronomiaɎicky^˿Ajquienesenoilesegustakelhpansconstomatesdicensquesesoisabesak.....j?j [18:03] Libelula{Paciente
Tri.15744 GastronomiaɎicky^˿Ajquienesenoilesegustakelhpansconstomatesdicensquesesoisabesak.....j?j
[18:03] Libelula{Paciente 1 Pista: *** ****** Valor pregunta : 9699 Puntos [18:03] Libelula{Paciente
1 Pista: *** ****** Valor pregunta : 9699 Puntos
[18:04] Libelula{Paciente 2 Pista: pan ****** 30 segundos y 9699 Puntos [18:04] Libelula{Paciente
2 Pista: pan ****** 30 segundos y 9699 Puntos
[18:04] Libelula{Paciente 3 Pista: pan *o*a*o 15 segundos y 9699 Puntos [18:04] Libelula{Paciente
3 Pista: pan *o*a*o 15 segundos y 9699 Puntos
[18:04] Libelula{Paciente Tiempo! La respuesta es -> pan�ojado <- [18:04] Libelula{Paciente
Tiempo! La respuesta es -> pan�ojado <-
[18:04] Libelula{Paciente If you think a Q&A is wrong, please call an OP [18:04] Libelula{Paciente
If you think a Q&A is wrong, please call an OP
[18:04] Libelula{Paciente Tri.13190 Geografiaɭarch˿Degqu郰1xmacizoaformampartegelqAneto?x?x [18:04] Libelula{Paciente
Tri.13190 Geografiaɭarch˿Degqu郰1xmacizoaformampartegelqAneto?x?x
[18:04] Libelula{Paciente 1 Pista: ****** ** ** ******** Valor pregunta : 17756 Puntos [18:04] Libelula{Paciente
1 Pista: ****** ** ** ******** Valor pregunta : 17756 Puntos
[18:05] Libelula{Paciente 2 Pista: mac*** ** ** ******** 30 segundos y 17756 Puntos [18:05] Libelula{Paciente
2 Pista: mac*** ** ** ******** 30 segundos y 17756 Puntos
[18:05] Libelula{Paciente 3 Pista: maci*o *e *a *a*a*e*a 15 segundos y 17756 Puntos [18:05] Libelula{Paciente
3 Pista: maci*o *e *a *a*a*e*a 15 segundos y 17756 Puntos
[18:05] Libelula{Paciente Tiempo! La respuesta es -> macizo�e�a�aladeta <- [18:05] Libelula{Paciente
Tiempo! La respuesta es -> macizo�e�a�aladeta <-
[18:05] Libelula{Paciente R᮫ing por D́: - Domingo: Ketzy 1150014 Lunes: Karen 1245745 Martes: {FoSFoRiTa} 388010 Miercoles: Cocodrilo\Suave 2638625 Jueves: Karen 824895 Viernes: Cocodrilo\Suave 2430737 Sᢡdo: welcome3 3286708 [18:05] Libelula{Paciente
R᮫ing por D́: - Domingo: Ketzy 1150014 Lunes: Karen 1245745 Martes: {FoSFoRiTa} 388010 Miercoles: Cocodrilo\Suave 2638625 Jueves: Karen 824895 Viernes: Cocodrilo\Suave 2430737 Sᢡdo: welcome3 3286708
[18:05] Libelula{Paciente Tri.8495 GeografiaɞIrati˿EltriogGlendarueltestჰ1aeny?a [18:05] Libelula{Paciente
Tri.8495 GeografiaɞIrati˿EltriogGlendarueltestჰ1aeny?a
[18:05] Libelula{Paciente 1 Pista: ******* Valor pregunta : 8714 Puntos [18:05] Libelula{Paciente
1 Pista: ******* Valor pregunta : 8714 Puntos
[18:06] Libelula{Paciente 2 Pista: esc**** 30 segundos y 8714 Puntos [18:06] Libelula{Paciente
2 Pista: esc**** 30 segundos y 8714 Puntos
[18:06] Libelula{Paciente 3 Pista: esco*ia 15 segundos y 8714 Puntos [18:06] Libelula{Paciente
3 Pista: esco*ia 15 segundos y 8714 Puntos
[18:06] Libelula{Paciente Tiempo! La respuesta es -> escocia <- [18:06] Libelula{Paciente
Tiempo! La respuesta es -> escocia <-
[18:06] Libelula{Paciente For The Competitive Edge type !pingme [18:06] Libelula{Paciente
For The Competitive Edge type !pingme
[18:06] Libelula{Paciente Tri.7422 Arteɖarios˿Deyqueyestiloparquitect󮩣opesrelhParten󮃰1xdeyAtenasr?b [18:06] Libelula{Paciente
Tri.7422 Arteɖarios˿Deyqueyestiloparquitect󮩣opesrelhParten󮃰1xdeyAtenasr?b
[18:06] Libelula{Paciente 1 Pista: ****** Valor pregunta : 15818 Puntos [18:06] Libelula{Paciente
1 Pista: ****** Valor pregunta : 15818 Puntos
[18:06] Libelula{Paciente 2 Pista: dor*** 30 segundos y 15818 Puntos [18:06] Libelula{Paciente
2 Pista: dor*** 30 segundos y 15818 Puntos
[18:07] Libelula{Paciente 3 Pista: dori*o 15 segundos y 15818 Puntos [18:07] Libelula{Paciente
3 Pista: dori*o 15 segundos y 15818 Puntos
[18:07] Libelula{Paciente Tiempo! La respuesta es -> dorico <- [18:07] Libelula{Paciente
Tiempo! La respuesta es -> dorico <-
[18:07] Libelula{Paciente Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [18:07] Libelula{Paciente
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[18:07] Libelula{Paciente Tri.2776 BiologiaɈdosO˿CoMOfSEfLLAMANfLOSfMICROORGANISMOSfQUEfVIVENfSINfOXiGENOf?f [18:07] Libelula{Paciente
Tri.2776 BiologiaɈdosO˿CoMOfSEfLLAMANfLOSfMICROORGANISMOSfQUEfVIVENfSINfOXiGENOf?f
[18:07] Libelula{Paciente 1 Pista: ********** Valor pregunta : 19826 Puntos [18:07] Libelula{Paciente
1 Pista: ********** Valor pregunta : 19826 Puntos
[18:07] Libelula{Paciente 2 Pista: ana******* 30 segundos y 19826 Puntos [18:07] Libelula{Paciente
2 Pista: ana******* 30 segundos y 19826 Puntos
[18:08] Libelula{Paciente 3 Pista: anae*o*io* 15 segundos y 19826 Puntos [18:08] Libelula{Paciente
3 Pista: anae*o*io* 15 segundos y 19826 Puntos
[18:08] Libelula{Paciente Tiempo! La respuesta es -> anaerobios <- [18:08] Libelula{Paciente
Tiempo! La respuesta es -> anaerobios <-
[18:08] Libelula{Paciente R᮫ing MES: - #1: welcome3 21243832 #2: Cocodrilo\Suave 15194668 #3: Danielitto 10886756 #4: Karen 9086159 #5: {FoSFoRiTa} 7343057 #6: Alii 5900389 #7: Grillo}Respetable 4163643 #8: Ketzy 1150014 #9: NN_vOx-14_Lagrimas-Progres 981673 #10: NN_vOx_Bukelizacion-YA 839312 [18:08] Libelula{Paciente
R᮫ing MES: - #1: welcome3 21243832 #2: Cocodrilo\Suave 15194668 #3: Danielitto 10886756 #4: Karen 9086159 #5: {FoSFoRiTa} 7343057 #6: Alii 5900389 #7: Grillo}Respetable 4163643 #8: Ketzy 1150014 #9: NN_vOx-14_Lagrimas-Progres 981673 #10: NN_vOx_Bukelizacion-YA 839312
[18:08] Libelula{Paciente Tri.17226 Gastronomiaɋwahamot˿Comoddebeltomarselunqzumoddelnaranjaiparaiquelestelnodpierdaisushvitaminash?n [18:08] Libelula{Paciente
Tri.17226 Gastronomiaɋwahamot˿Comoddebeltomarselunqzumoddelnaranjaiparaiquelestelnodpierdaisushvitaminash?n
[18:08] Libelula{Paciente 1 Pista: ****** ********* Valor pregunta : 16342 Puntos [18:08] Libelula{Paciente
1 Pista: ****** ********* Valor pregunta : 16342 Puntos
[18:08] Libelula{Paciente 2 Pista: rec*** ********* 30 segundos y 16342 Puntos [18:08] Libelula{Paciente
2 Pista: rec*** ********* 30 segundos y 16342 Puntos
[18:09] Libelula{Paciente 3 Pista: recie* e***i*i*o 15 segundos y 16342 Puntos [18:09] Libelula{Paciente
3 Pista: recie* e***i*i*o 15 segundos y 16342 Puntos
[18:09] Libelula{Paciente Tiempo! La respuesta es -> recien�xprimido <- [18:09] Libelula{Paciente
Tiempo! La respuesta es -> recien�xprimido <-
[18:09] Libelula{Paciente Please refrain from using Extreme Bad Language [18:09] Libelula{Paciente
Please refrain from using Extreme Bad Language
[18:09] Libelula{Paciente Tri.13760 Biologiaɂatval˿COMOmSEmLLAMAmELmPINOmGREATmBASINmDEm4.723mA񏓃01mDEmEDAD,mCONSIDERADOmELmARBOLmMASmVIEJO?m?m [18:09] Libelula{Paciente
Tri.13760 Biologiaɂatval˿COMOmSEmLLAMAmELmPINOmGREATmBASINmDEm4.723mA񏓃01mDEmEDAD,mCONSIDERADOmELmARBOLmMASmVIEJO?m?m
[18:09] Libelula{Paciente 1 Pista: ********* Valor pregunta : 11481 Puntos [18:09] Libelula{Paciente
1 Pista: ********* Valor pregunta : 11481 Puntos
[18:09] Libelula{Paciente 2 Pista: mat****** 30 segundos y 11481 Puntos [18:09] Libelula{Paciente
2 Pista: mat****** 30 segundos y 11481 Puntos
[18:09] Libelula{Paciente 3 Pista: matu*a*e* 15 segundos y 11481 Puntos [18:09] Libelula{Paciente
3 Pista: matu*a*e* 15 segundos y 11481 Puntos
[18:10] Libelula{Paciente Tiempo! La respuesta es -> matusalen <- [18:10] Libelula{Paciente
Tiempo! La respuesta es -> matusalen <-
[18:10] Libelula{Paciente This is #Mexico, I am your host Libelula{Paciente, running Libelula{Paciente [18:10] Libelula{Paciente
This is #Mexico, I am your host Libelula{Paciente, running Libelula{Paciente
[18:10] Libelula{Paciente Tri.16490 Medicina-Saludɤassler˿D󮤥nsengeneralelil�idomcefalo-raqu�o?d?d [18:10] Libelula{Paciente
Tri.16490 Medicina-Saludɤassler˿D󮤥nsengeneralelil�idomcefalo-raqu�o?d?d
[18:10] Libelula{Paciente 1 Pista: ****** ********* Valor pregunta : 23852 Puntos [18:10] Libelula{Paciente
1 Pista: ****** ********* Valor pregunta : 23852 Puntos
[18:10] Libelula{Paciente 2 Pista: ple*** ********* 30 segundos y 23852 Puntos [18:10] Libelula{Paciente
2 Pista: ple*** ********* 30 segundos y 23852 Puntos
[18:10] Libelula{Paciente 3 Pista: ple*o* *o*oi*eo* 15 segundos y 23852 Puntos [18:10] Libelula{Paciente
3 Pista: ple*o* *o*oi*eo* 15 segundos y 23852 Puntos
[18:11] Libelula{Paciente Tiempo! La respuesta es -> plexos�oroideos <- [18:11] Libelula{Paciente
Tiempo! La respuesta es -> plexos�oroideos <-
[18:11] Libelula{Paciente This WEEKS Top 11-20: - #11: Unheimlich 343574 #12: HeaLth_Rider 267851 #13: wilby 87595 #14: Cobaya{Letal12 85108 #15: welcome3 74396 #16: joooooovencito_67 54103 #17: Elefante{Humilde 44016 #18: RuBeN_Mty- 39820 #19: cubanito 31826 #20: LeCaTwaLk_z 25000 [18:11] Libelula{Paciente
This WEEKS Top 11-20: - #11: Unheimlich 343574 #12: HeaLth_Rider 267851 #13: wilby 87595 #14: Cobaya{Letal12 85108 #15: welcome3 74396 #16: joooooovencito_67 54103 #17: Elefante{Humilde 44016 #18: RuBeN_Mty- 39820 #19: cubanito 31826 #20: LeCaTwaLk_z 25000
[18:11] Libelula{Paciente Tri.4236 Deporteɚytox˿Hipica:Terminowinglesdparahdesignarnlasdanteojerasddealosdcaballosd?j [18:11] Libelula{Paciente
Tri.4236 Deporteɚytox˿Hipica:Terminowinglesdparahdesignarnlasdanteojerasddealosdcaballosd?j
[18:11] Libelula{Paciente 1 Pista: ******** Valor pregunta : 19360 Puntos [18:11] Libelula{Paciente
1 Pista: ******** Valor pregunta : 19360 Puntos
[18:11] Libelula{Paciente 2 Pista: bli***** 30 segundos y 19360 Puntos [18:11] Libelula{Paciente
2 Pista: bli***** 30 segundos y 19360 Puntos
[18:11] Libelula{Paciente 3 Pista: bli**e** 15 segundos y 19360 Puntos [18:11] Libelula{Paciente
3 Pista: bli**e** 15 segundos y 19360 Puntos
[18:12] Libelula{Paciente Tiempo! La respuesta es -> blinkers <- [18:12] Libelula{Paciente
Tiempo! La respuesta es -> blinkers <-
[18:12] Libelula{Paciente Trivial AUTO Parado. Para reiniciar el Trivial escriba !jugar [18:12] Libelula{Paciente
Trivial AUTO Parado. Para reiniciar el Trivial escriba !jugar
| Compartir en: