Historia de #mexico 08/02/2026 01:19 2 visitas

Reportar Volver Historia anterior Historia siguiente
Hour Alias Mensaje Mensaje
[01:19] LibelulaBreve EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!! [01:19] LibelulaBreve
EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!!
[01:19] Aguila}Torpe !jugar [01:19] Aguila}Torpe
!jugar
[01:19] LibelulaBreve R᮫ing �ltima SEMANA: #1: welcome3 12330173 #2: Danielitto 9371569 #3: HormigaPedante 4168422 [01:19] LibelulaBreve
R᮫ing �ltima SEMANA: #1: welcome3 12330173 #2: Danielitto 9371569 #3: HormigaPedante 4168422
[01:19] LibelulaBreve Tri.18893 Personajesɪoam˿Entqu郰1dpa�01kmuri󃰱dDescartes?d?d [01:19] LibelulaBreve
Tri.18893 Personajesɪoam˿Entqu郰1dpa�01kmuri󃰱dDescartes?d?d
[01:19] LibelulaBreve 1 Pista: ****** Valor pregunta : 7354 Puntos [01:19] LibelulaBreve
1 Pista: ****** Valor pregunta : 7354 Puntos
[01:19] LibelulaBreve 2 Pista: sue*** 30 segundos y 7354 Puntos [01:19] LibelulaBreve
2 Pista: sue*** 30 segundos y 7354 Puntos
[01:20] LibelulaBreve 3 Pista: sue*ia 15 segundos y 7354 Puntos [01:20] LibelulaBreve
3 Pista: sue*ia 15 segundos y 7354 Puntos
[01:20] LibelulaBreve Tiempo! La respuesta es -> suecia <- [01:20] LibelulaBreve
Tiempo! La respuesta es -> suecia <-
[01:20] LibelulaBreve Nuevo D́,todos a cero!! [01:20] LibelulaBreve
Nuevo D́,todos a cero!!
[01:20] LibelulaBreve Nueva SEMANA,todos a cero!! [01:20] LibelulaBreve
Nueva SEMANA,todos a cero!!
[01:20] LibelulaBreve Cleared Top Ten Weekly Scores [01:20] LibelulaBreve
Cleared Top Ten Weekly Scores
[01:20] LibelulaBreve Top10 Players ( Weekly & Monthly ) are Auto-Voiced [01:20] LibelulaBreve
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[01:20] LibelulaBreve Tri.2994 Fisica-QuimicaɃort˿ConaQuezelementojdebemosbdopareunacristalidezsiliciojparakobtenereunasemiconductoredeztipojNs?s [01:20] LibelulaBreve
Tri.2994 Fisica-QuimicaɃort˿ConaQuezelementojdebemosbdopareunacristalidezsiliciojparakobtenereunasemiconductoredeztipojNs?s
[01:20] LibelulaBreve 1 Pista: ********* * ******** Valor pregunta : 14656 Puntos [01:20] LibelulaBreve
1 Pista: ********* * ******** Valor pregunta : 14656 Puntos
[01:20] LibelulaBreve 2 Pista: ant****** * ******** 30 segundos y 14656 Puntos [01:20] LibelulaBreve
2 Pista: ant****** * ******** 30 segundos y 14656 Puntos
[01:21] LibelulaBreve 3 Pista: anti*o*io o a**e*i*o 15 segundos y 14656 Puntos [01:21] LibelulaBreve
3 Pista: anti*o*io o a**e*i*o 15 segundos y 14656 Puntos
[01:21] LibelulaBreve Tiempo! La respuesta es -> antimonio��rsenico <- [01:21] LibelulaBreve
Tiempo! La respuesta es -> antimonio��rsenico <-
[01:21] LibelulaBreve Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [01:21] LibelulaBreve
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[01:21] LibelulaBreve Tri.4089 Musicaɬatribu˿Dexorigentperuano,arepresent󃰱aayEspa񡬃01aesluntdecir,aentEurovisi󮬃01aelda񯃰1qdespu鳃01ldexMikif?a [01:21] LibelulaBreve
Tri.4089 Musicaɬatribu˿Dexorigentperuano,arepresent󃰱aayEspa񡬃01aesluntdecir,aentEurovisi󮬃01aelda񯃰1qdespu鳃01ldexMikif?a
[01:21] LibelulaBreve 1 Pista: ***** ******** Valor pregunta : 23199 Puntos [01:21] LibelulaBreve
1 Pista: ***** ******** Valor pregunta : 23199 Puntos
[01:21] LibelulaBreve 2 Pista: bet** ******** 30 segundos y 23199 Puntos [01:21] LibelulaBreve
2 Pista: bet** ******** 30 segundos y 23199 Puntos
[01:22] LibelulaBreve 3 Pista: bet** *i**ie*o 15 segundos y 23199 Puntos [01:22] LibelulaBreve
3 Pista: bet** *i**ie*o 15 segundos y 23199 Puntos
[01:22] LibelulaBreve Tiempo! La respuesta es -> betty�issiego <- [01:22] LibelulaBreve
Tiempo! La respuesta es -> betty�issiego <-
[01:22] LibelulaBreve Tri.17700 Biologiaɬusie˿C󭯃01lsecllamadladmasaddectejidolquecsecalargadentformaddecpicolentladflorqdeclasrorqu�as?m?m [01:22] LibelulaBreve
Tri.17700 Biologiaɬusie˿C󭯃01lsecllamadladmasaddectejidolquecsecalargadentformaddecpicolentladflorqdeclasrorqu�as?m?m
[01:22] LibelulaBreve 1 Pista: ******* Valor pregunta : 8467 Puntos [01:22] LibelulaBreve
1 Pista: ******* Valor pregunta : 8467 Puntos
[01:22] LibelulaBreve 2 Pista: ros**** 30 segundos y 8467 Puntos [01:22] LibelulaBreve
2 Pista: ros**** 30 segundos y 8467 Puntos
[01:22] LibelulaBreve 3 Pista: ros*e*o 15 segundos y 8467 Puntos [01:22] LibelulaBreve
3 Pista: ros*e*o 15 segundos y 8467 Puntos
[01:23] LibelulaBreve Tiempo! La respuesta es -> rostelo <- [01:23] LibelulaBreve
Tiempo! La respuesta es -> rostelo <-
[01:23] LibelulaBreve We feature over 50,000 Q&A ! [01:23] LibelulaBreve
We feature over 50,000 Q&A !
[01:23] LibelulaBreve Tri.9015 Historiaɓibila˿CONgQUIɎgSEgCASӃ01gGERMANAgDEgFOIX?g?g [01:23] LibelulaBreve
Tri.9015 Historiaɓibila˿CONgQUIɎgSEgCASӃ01gGERMANAgDEgFOIX?g?g
[01:23] LibelulaBreve 1 Pista: ******** ** ** ******** Valor pregunta : 10976 Puntos [01:23] LibelulaBreve
1 Pista: ******** ** ** ******** Valor pregunta : 10976 Puntos
[01:23] LibelulaBreve 2 Pista: fer***** ** ** ******** 30 segundos y 10976 Puntos [01:23] LibelulaBreve
2 Pista: fer***** ** ** ******** 30 segundos y 10976 Puntos
[01:23] LibelulaBreve 3 Pista: fer*a**o ii e* *a*o*i*o 15 segundos y 10976 Puntos [01:23] LibelulaBreve
3 Pista: fer*a**o ii e* *a*o*i*o 15 segundos y 10976 Puntos
[01:24] LibelulaBreve Tiempo! La respuesta es -> fernando�i�l�atolico <- [01:24] LibelulaBreve
Tiempo! La respuesta es -> fernando�i�l�atolico <-
[01:24] LibelulaBreve Tri.17934 CancionesɃHESARE˿CongqueocanciongrepresentokapEspa񡃰1pVickyhLarrazjengelxfestivalxdeoeurovisiong?j [01:24] LibelulaBreve
Tri.17934 CancionesɃHESARE˿CongqueocanciongrepresentokapEspa񡃰1pVickyhLarrazjengelxfestivalxdeoeurovisiong?j
[01:24] LibelulaBreve 1 Pista: ******* Valor pregunta : 15288 Puntos [01:24] LibelulaBreve
1 Pista: ******* Valor pregunta : 15288 Puntos
[01:24] LibelulaBreve 2 Pista: sam**** 30 segundos y 15288 Puntos [01:24] LibelulaBreve
2 Pista: sam**** 30 segundos y 15288 Puntos
[01:24] Gata_Suave samanta [01:24] Gata_Suave
samanta
[01:24] LibelulaBreve 3 Pista: samu*ai 15 segundos y 15288 Puntos [01:24] LibelulaBreve
3 Pista: samu*ai 15 segundos y 15288 Puntos
[01:24] LibelulaBreve �emuestra lo que sabes Gata_Suave! Has respondido "samurai" correctamente y eso te da: �5288�12 puntos [01:24] LibelulaBreve
�emuestra lo que sabes Gata_Suave! Has respondido "samurai" correctamente y eso te da: �5288�12 puntos
[01:24] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [01:24] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[01:24] LibelulaBreve Gata_Suave has acertado 1 seguidas!! Puntos HOY: 15288, SEMANA: 15288 y MES: 15288 [01:24] LibelulaBreve
Gata_Suave has acertado 1 seguidas!! Puntos HOY: 15288, SEMANA: 15288 y MES: 15288
[01:24] Gata_Suave samurai [01:24] Gata_Suave
samurai
[01:25] LibelulaBreve Tri.2156 BiologiaɓESINO˿C󭯃01psejllamafaflafexcrecenciafquejsejformafenpalgunosivegetalesiporqlafpicadurafoppuestafdejhuevosidejciertosiinsectos?i?i [01:25] LibelulaBreve
Tri.2156 BiologiaɓESINO˿C󭯃01psejllamafaflafexcrecenciafquejsejformafenpalgunosivegetalesiporqlafpicadurafoppuestafdejhuevosidejciertosiinsectos?i?i
[01:25] LibelulaBreve 1 Pista: ****** Valor pregunta : 22062 Puntos [01:25] LibelulaBreve
1 Pista: ****** Valor pregunta : 22062 Puntos
[01:25] LibelulaBreve 2 Pista: aga*** 30 segundos y 22062 Puntos [01:25] LibelulaBreve
2 Pista: aga*** 30 segundos y 22062 Puntos
[01:25] LibelulaBreve 3 Pista: aga**a 15 segundos y 22062 Puntos [01:25] LibelulaBreve
3 Pista: aga**a 15 segundos y 22062 Puntos
[01:25] LibelulaBreve Tiempo! La respuesta es -> agalla <- [01:25] LibelulaBreve
Tiempo! La respuesta es -> agalla <-
[01:25] LibelulaBreve Please remember this is a FREE service, Please do not complain [01:25] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[01:25] LibelulaBreve Tri.17895 Cancionesɫosako˿Ganovcantandov"desdebquebllegastebyawnovvivovllorando...heyc!..."m?m [01:25] LibelulaBreve
Tri.17895 Cancionesɫosako˿Ganovcantandov"desdebquebllegastebyawnovvivovllorando...heyc!..."m?m
[01:25] LibelulaBreve 1 Pista: ****** Valor pregunta : 13766 Puntos [01:25] LibelulaBreve
1 Pista: ****** Valor pregunta : 13766 Puntos
[01:26] LibelulaBreve 2 Pista: sal*** 30 segundos y 13766 Puntos [01:26] LibelulaBreve
2 Pista: sal*** 30 segundos y 13766 Puntos
[01:26] LibelulaBreve 3 Pista: salo*e 15 segundos y 13766 Puntos [01:26] LibelulaBreve
3 Pista: salo*e 15 segundos y 13766 Puntos
[01:26] LibelulaBreve Tiempo! La respuesta es -> salome <- [01:26] LibelulaBreve
Tiempo! La respuesta es -> salome <-
[01:26] LibelulaBreve R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663 [01:26] LibelulaBreve
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663
[01:26] LibelulaBreve Tri.8127 Literaturaɳorgo˿LOSlPAZOSlDElULLOAlFUElOBRAlDE?l?l [01:26] LibelulaBreve
Tri.8127 Literaturaɳorgo˿LOSlPAZOSlDElULLOAlFUElOBRAlDE?l?l
[01:26] LibelulaBreve 1 Pista: ****** ***** ***** Valor pregunta : 13992 Puntos [01:26] LibelulaBreve
1 Pista: ****** ***** ***** Valor pregunta : 13992 Puntos
[01:27] LibelulaBreve 2 Pista: emi*** ***** ***** 30 segundos y 13992 Puntos [01:27] LibelulaBreve
2 Pista: emi*** ***** ***** 30 segundos y 13992 Puntos
[01:27] LibelulaBreve 3 Pista: emi*ia *a**o *a*a* 15 segundos y 13992 Puntos [01:27] LibelulaBreve
3 Pista: emi*ia *a**o *a*a* 15 segundos y 13992 Puntos
[01:27] LibelulaBreve Tiempo! La respuesta es -> emilia�ardo�azan <- [01:27] LibelulaBreve
Tiempo! La respuesta es -> emilia�ardo�azan <-
[01:27] LibelulaBreve If you think a Q&A is wrong, please call an OP [01:27] LibelulaBreve
If you think a Q&A is wrong, please call an OP
[01:27] LibelulaBreve Tri.13993 Cienciaɳtephenwo˿Enzdondepsepconstruyeronzloslprimeroslcanaleslparaqtransportarueldagua?w?w [01:27] LibelulaBreve
Tri.13993 Cienciaɳtephenwo˿Enzdondepsepconstruyeronzloslprimeroslcanaleslparaqtransportarueldagua?w?w
[01:27] LibelulaBreve 1 Pista: *********** Valor pregunta : 19936 Puntos [01:27] LibelulaBreve
1 Pista: *********** Valor pregunta : 19936 Puntos
[01:28] LibelulaBreve 2 Pista: mes******** 30 segundos y 19936 Puntos [01:28] LibelulaBreve
2 Pista: mes******** 30 segundos y 19936 Puntos
[01:28] Gata_Suave mesoamerica [01:28] Gata_Suave
mesoamerica
[01:28] Gata_Suave mesopotamia [01:28] Gata_Suave
mesopotamia
[01:28] LibelulaBreve �Suma y sigue Gata_Suave!! La respuesta: "mesopotamia" incrementa tu marcador en �9936�12 puntos [01:28] LibelulaBreve
�Suma y sigue Gata_Suave!! La respuesta: "mesopotamia" incrementa tu marcador en �9936�12 puntos
[01:28] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [01:28] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[01:28] LibelulaBreve Gata_Suave has acertado 2 seguidas!! Puntos HOY: 35224, SEMANA: 35224 y MES: 35224 [01:28] LibelulaBreve
Gata_Suave has acertado 2 seguidas!! Puntos HOY: 35224, SEMANA: 35224 y MES: 35224
[01:28] LibelulaBreve R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708 [01:28] LibelulaBreve
R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708
[01:28] LibelulaBreve Tri.17879 Economiaɖivianne˿DENOMINACIONvDELvVALorncontableedeeunaucuentauauunauFECHAvDADAv?v [01:28] LibelulaBreve
Tri.17879 Economiaɖivianne˿DENOMINACIONvDELvVALorncontableedeeunaucuentauauunauFECHAvDADAv?v
[01:28] LibelulaBreve 1 Pista: ***** Valor pregunta : 9288 Puntos [01:28] LibelulaBreve
1 Pista: ***** Valor pregunta : 9288 Puntos
[01:28] LibelulaBreve 2 Pista: sal** 30 segundos y 9288 Puntos [01:28] LibelulaBreve
2 Pista: sal** 30 segundos y 9288 Puntos
[01:28] LibelulaBreve 3 Pista: sal*o 15 segundos y 9288 Puntos [01:28] LibelulaBreve
3 Pista: sal*o 15 segundos y 9288 Puntos
[01:29] LibelulaBreve Tiempo! La respuesta es -> saldo <- [01:29] LibelulaBreve
Tiempo! La respuesta es -> saldo <-
[01:29] LibelulaBreve For The Competitive Edge type !pingme [01:29] LibelulaBreve
For The Competitive Edge type !pingme
[01:29] LibelulaBreve Tri.7709 Cienciaɳtephenwo˿Enjqueqpa�01gestჰ1llatantenatdeqtelevisi󮃰1jm᳃01galtatdelumundoeconj628lmetros?l?l [01:29] LibelulaBreve
Tri.7709 Cienciaɳtephenwo˿Enjqueqpa�01gestჰ1llatantenatdeqtelevisi󮃰1jm᳃01galtatdelumundoeconj628lmetros?l?l
[01:29] LibelulaBreve 1 Pista: **** Valor pregunta : 12467 Puntos [01:29] LibelulaBreve
1 Pista: **** Valor pregunta : 12467 Puntos
[01:29] LibelulaBreve 2 Pista: eeu* 30 segundos y 12467 Puntos [01:29] LibelulaBreve
2 Pista: eeu* 30 segundos y 12467 Puntos
[01:29] LibelulaBreve 3 Pista: eeuu 15 segundos y 12467 Puntos [01:29] LibelulaBreve
3 Pista: eeuu 15 segundos y 12467 Puntos
[01:30] LibelulaBreve Tiempo! La respuesta es -> eeuu <- [01:30] LibelulaBreve
Tiempo! La respuesta es -> eeuu <-
[01:30] LibelulaBreve Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [01:30] LibelulaBreve
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[01:30] LibelulaBreve Tri.16896 Medicina-SaludɄarklest˿Asquerparterdelocuerpohafectaoeloenfisema?s?s [01:30] LibelulaBreve
Tri.16896 Medicina-SaludɄarklest˿Asquerparterdelocuerpohafectaoeloenfisema?s?s
[01:30] LibelulaBreve 1 Pista: ******** Pregunta de BONUS : 200000 Puntos [01:30] LibelulaBreve
1 Pista: ******** Pregunta de BONUS : 200000 Puntos
[01:30] Gata_Suave pulmones [01:30] Gata_Suave
pulmones
[01:30] LibelulaBreve �Est᳠que lo tiras Gata_Suave!! ߃󭯠supiste que "pulmones" era la respuesta? Venga, �00000�12 puntos suben a tu marcador [01:30] LibelulaBreve
�Est᳠que lo tiras Gata_Suave!! ߃󭯠supiste que "pulmones" era la respuesta? Venga, �00000�12 puntos suben a tu marcador
[01:30] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [01:30] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[01:30] LibelulaBreve Gata_Suave has acertado 3 seguidas!! Puntos HOY: 235224, SEMANA: 235224 y MES: 235224 [01:30] LibelulaBreve
Gata_Suave has acertado 3 seguidas!! Puntos HOY: 235224, SEMANA: 235224 y MES: 235224
[01:30] LibelulaBreve R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: NN_vOx_Bukelizacion-YA 839312 #9: NN_vOx_Infierno-Fiscal 407404 #10: kitana_- 299678 [01:30] LibelulaBreve
R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: NN_vOx_Bukelizacion-YA 839312 #9: NN_vOx_Infierno-Fiscal 407404 #10: kitana_- 299678
[01:30] LibelulaBreve Tri.6673 Historiaɐsico666ˣoncubinakdewSans󮃰1tquewlodtraicion󃰱g?g [01:30] LibelulaBreve
Tri.6673 Historiaɐsico666ˣoncubinakdewSans󮃰1tquewlodtraicion󃰱g?g
[01:30] LibelulaBreve 1 Pista: ****** Valor pregunta : 21351 Puntos [01:30] LibelulaBreve
1 Pista: ****** Valor pregunta : 21351 Puntos
[01:30] LibelulaBreve 2 Pista: dal*** 30 segundos y 21351 Puntos [01:30] LibelulaBreve
2 Pista: dal*** 30 segundos y 21351 Puntos
[01:30] LibelulaBreve �e nota que sabes mucho de esto Gata_Suave! Tu respuesta "dalila" es correcta y ganas �1351�12 puntos [01:30] LibelulaBreve
�e nota que sabes mucho de esto Gata_Suave! Tu respuesta "dalila" es correcta y ganas �1351�12 puntos
[01:30] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [01:30] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[01:30] LibelulaBreve Gata_Suave has acertado 4 seguidas!! Puntos HOY: 256575, SEMANA: 256575 y MES: 256575 [01:30] LibelulaBreve
Gata_Suave has acertado 4 seguidas!! Puntos HOY: 256575, SEMANA: 256575 y MES: 256575
[01:30] Gata_Suave dalila [01:30] Gata_Suave
dalila
[01:31] LibelulaBreve Please refrain from using Extreme Bad Language [01:31] LibelulaBreve
Please refrain from using Extreme Bad Language
[01:31] LibelulaBreve Tri.2503 Historiaɴjmm.com˿Alqui鮃01hesgatribuidopelatextopjur�copbajomedievala"C󤩧opdezlasgSietezPartidas"?l?l [01:31] LibelulaBreve
Tri.2503 Historiaɴjmm.com˿Alqui鮃01hesgatribuidopelatextopjur�copbajomedievala"C󤩧opdezlasgSietezPartidas"?l?l
[01:31] LibelulaBreve 1 Pista: ******* * ** ***** Valor pregunta : 10417 Puntos [01:31] LibelulaBreve
1 Pista: ******* * ** ***** Valor pregunta : 10417 Puntos
[01:31] LibelulaBreve 2 Pista: alf**** * ** ***** 30 segundos y 10417 Puntos [01:31] LibelulaBreve
2 Pista: alf**** * ** ***** 30 segundos y 10417 Puntos
[01:31] LibelulaBreve 3 Pista: alfo**o * e* *a*io 15 segundos y 10417 Puntos [01:31] LibelulaBreve
3 Pista: alfo**o * e* *a*io 15 segundos y 10417 Puntos
[01:31] LibelulaBreve Tiempo! La respuesta es -> alfonso��l�abio <- [01:31] LibelulaBreve
Tiempo! La respuesta es -> alfonso��l�abio <-
[01:31] LibelulaBreve This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve [01:31] LibelulaBreve
This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve
[01:31] LibelulaBreve Tri.12596 Economiaɬusieˍonedasgdelkmundo:fMonedagdekSierragLeonag?f [01:31] LibelulaBreve
Tri.12596 Economiaɬusieˍonedasgdelkmundo:fMonedagdekSierragLeonag?f
[01:31] LibelulaBreve 1 Pista: ***** Valor pregunta : 21728 Puntos [01:31] LibelulaBreve
1 Pista: ***** Valor pregunta : 21728 Puntos
[01:32] LibelulaBreve 2 Pista: leo** 30 segundos y 21728 Puntos [01:32] LibelulaBreve
2 Pista: leo** 30 segundos y 21728 Puntos
[01:32] LibelulaBreve 3 Pista: leo*e 15 segundos y 21728 Puntos [01:32] LibelulaBreve
3 Pista: leo*e 15 segundos y 21728 Puntos
[01:32] LibelulaBreve Tiempo! La respuesta es -> leone <- [01:32] LibelulaBreve
Tiempo! La respuesta es -> leone <-
[01:32] LibelulaBreve This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [01:32] LibelulaBreve
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[01:32] LibelulaBreve Tri.19719 MiscelaneaɍARdeJAVA˔GV,oAVE,oTALGO,oSHINKANSEN...oDEoQUɃ01oMEDIOoDEoTRANSPORTEoSEoTRATA?o?o [01:32] LibelulaBreve
Tri.19719 MiscelaneaɍARdeJAVA˔GV,oAVE,oTALGO,oSHINKANSEN...oDEoQUɃ01oMEDIOoDEoTRANSPORTEoSEoTRATA?o?o
[01:32] LibelulaBreve 1 Pista: **** Valor pregunta : 18793 Puntos [01:32] LibelulaBreve
1 Pista: **** Valor pregunta : 18793 Puntos
[01:33] LibelulaBreve 2 Pista: tre* 30 segundos y 18793 Puntos [01:33] LibelulaBreve
2 Pista: tre* 30 segundos y 18793 Puntos
[01:33] LibelulaBreve 3 Pista: tre* 15 segundos y 18793 Puntos [01:33] LibelulaBreve
3 Pista: tre* 15 segundos y 18793 Puntos
[01:33] LibelulaBreve Tiempo! La respuesta es -> tren <- [01:33] LibelulaBreve
Tiempo! La respuesta es -> tren <-
[01:33] LibelulaBreve Please remember this is a FREE service, Please do not complain [01:33] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[01:33] LibelulaBreve Tri.2671 Biologiaɐegaso_R˿DEwQUEwCOLORwESwLAwFLORwDEwLAwMIMOSAw?w [01:33] LibelulaBreve
Tri.2671 Biologiaɐegaso_R˿DEwQUEwCOLORwESwLAwFLORwDEwLAwMIMOSAw?w
[01:33] LibelulaBreve 1 Pista: ******** Valor pregunta : 10571 Puntos [01:33] LibelulaBreve
1 Pista: ******** Valor pregunta : 10571 Puntos
[01:34] LibelulaBreve 2 Pista: ama***** 30 segundos y 10571 Puntos [01:34] LibelulaBreve
2 Pista: ama***** 30 segundos y 10571 Puntos
[01:34] LibelulaBreve 3 Pista: ama*i**o 15 segundos y 10571 Puntos [01:34] LibelulaBreve
3 Pista: ama*i**o 15 segundos y 10571 Puntos
[01:34] LibelulaBreve Tiempo! La respuesta es -> amarillo <- [01:34] LibelulaBreve
Tiempo! La respuesta es -> amarillo <-
[01:34] LibelulaBreve This MONTHS Top 11-20: - #11: Guerrero08 297002 #12: KaZuMa_KiRyU 258500 #13: Gata_Suave 256575 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 69726 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065 [01:34] LibelulaBreve
This MONTHS Top 11-20: - #11: Guerrero08 297002 #12: KaZuMa_KiRyU 258500 #13: Gata_Suave 256575 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 69726 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065
[01:34] LibelulaBreve Tri.19708 Medicina-Saludɒachy˿Enblauincapacidadpparautenerjhijosjcuantosjcasosjsebdebenbaulauinfertilidadpmasculina?n(porcentaje)n?n [01:34] LibelulaBreve
Tri.19708 Medicina-Saludɒachy˿Enblauincapacidadpparautenerjhijosjcuantosjcasosjsebdebenbaulauinfertilidadpmasculina?n(porcentaje)n?n
[01:34] LibelulaBreve 1 Pista: ******* *** ****** Valor pregunta : 18566 Puntos [01:34] LibelulaBreve
1 Pista: ******* *** ****** Valor pregunta : 18566 Puntos
[01:34] LibelulaBreve 2 Pista: tre**** *** ****** 30 segundos y 18566 Puntos [01:34] LibelulaBreve
2 Pista: tre**** *** ****** 30 segundos y 18566 Puntos
[01:35] LibelulaBreve 3 Pista: trei**a *o* *ie**o 15 segundos y 18566 Puntos [01:35] LibelulaBreve
3 Pista: trei**a *o* *ie**o 15 segundos y 18566 Puntos
[01:35] LibelulaBreve Tiempo! La respuesta es -> treinta�or�iento <- [01:35] LibelulaBreve
Tiempo! La respuesta es -> treinta�or�iento <-
[01:35] LibelulaBreve R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 [01:35] LibelulaBreve
R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244
[01:35] LibelulaBreve Tri.2969 Cotilleo-TVɡnghara˿Enpqu郰1kcadenaxdehTVkdanp(2005)kelfsorteohdelfcuponpdehlaxONCE?k?k [01:35] LibelulaBreve
Tri.2969 Cotilleo-TVɡnghara˿Enpqu郰1kcadenaxdehTVkdanp(2005)kelfsorteohdelfcuponpdehlaxONCE?k?k
[01:35] LibelulaBreve 1 Pista: ****** * Valor pregunta : 8721 Puntos [01:35] LibelulaBreve
1 Pista: ****** * Valor pregunta : 8721 Puntos
[01:35] LibelulaBreve 2 Pista: ant*** * 30 segundos y 8721 Puntos [01:35] LibelulaBreve
2 Pista: ant*** * 30 segundos y 8721 Puntos
[01:36] LibelulaBreve 3 Pista: ante*a * 15 segundos y 8721 Puntos [01:36] LibelulaBreve
3 Pista: ante*a * 15 segundos y 8721 Puntos
[01:36] LibelulaBreve Tiempo! La respuesta es -> antena� <- [01:36] LibelulaBreve
Tiempo! La respuesta es -> antena� <-
[01:36] LibelulaBreve Top10 Players ( Weekly & Monthly ) are Auto-Voiced [01:36] LibelulaBreve
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[01:36] LibelulaBreve Tri.7901 MusicaɅSTELA˿C󭯃01fsestitulaeelcalbumbqueseditaroneM.cRios,cAnaeBelen,cVictoryManuelcyaSerratp?c [01:36] LibelulaBreve
Tri.7901 MusicaɅSTELA˿C󭯃01fsestitulaeelcalbumbqueseditaroneM.cRios,cAnaeBelen,cVictoryManuelcyaSerratp?c
[01:36] LibelulaBreve 1 Pista: ** ***** ** ******* Valor pregunta : 14121 Puntos [01:36] LibelulaBreve
1 Pista: ** ***** ** ******* Valor pregunta : 14121 Puntos
[01:36] LibelulaBreve 2 Pista: el�**** ** ******* 30 segundos y 14121 Puntos [01:36] LibelulaBreve
2 Pista: el�**** ** ******* 30 segundos y 14121 Puntos
[01:37] LibelulaBreve 3 Pista: el�u**o e* *ue***o 15 segundos y 14121 Puntos [01:37] LibelulaBreve
3 Pista: el�u**o e* *ue***o 15 segundos y 14121 Puntos
[01:37] Ardilla_Transparente Bienvenido Danielitto ADMIN de Radio Luna de Miel. [01:37] Ardilla_Transparente
Bienvenido Danielitto ADMIN de Radio Luna de Miel.
[01:37] LibelulaBreve Tiempo! La respuesta es -> el�usto�s�uestro <- [01:37] LibelulaBreve
Tiempo! La respuesta es -> el�usto�s�uestro <-
[01:37] LibelulaBreve Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [01:37] LibelulaBreve
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[01:37] LibelulaBreve Tri.581 Informaticaɐax˿Cuantanmemorianten�01nelvreproductorydeoMP3r"RIOrPMP300"?r(enjMB)r?r [01:37] LibelulaBreve
Tri.581 Informaticaɐax˿Cuantanmemorianten�01nelvreproductorydeoMP3r"RIOrPMP300"?r(enjMB)r?r
[01:37] LibelulaBreve 1 Pista: ** Valor pregunta : 13973 Puntos [01:37] LibelulaBreve
1 Pista: ** Valor pregunta : 13973 Puntos
[01:37] LibelulaBreve 2 Pista: 32 30 segundos y 13973 Puntos [01:37] LibelulaBreve
2 Pista: 32 30 segundos y 13973 Puntos
[01:37] LibelulaBreve 3 Pista: 32 15 segundos y 13973 Puntos [01:37] LibelulaBreve
3 Pista: 32 15 segundos y 13973 Puntos
[01:38] LibelulaBreve Tiempo! La respuesta es -> 32 <- [01:38] LibelulaBreve
Tiempo! La respuesta es -> 32 <-
[01:38] LibelulaBreve Tri.13576 Cotilleo-TVɚytox˿DeiqueicantanteiseihaxseparadogPepeiSanchog?f [01:38] LibelulaBreve
Tri.13576 Cotilleo-TVɚytox˿DeiqueicantanteiseihaxseparadogPepeiSanchog?f
[01:38] LibelulaBreve 1 Pista: ***** ******* Valor pregunta : 8944 Puntos [01:38] LibelulaBreve
1 Pista: ***** ******* Valor pregunta : 8944 Puntos
[01:38] LibelulaBreve 2 Pista: mar** ******* 30 segundos y 8944 Puntos [01:38] LibelulaBreve
2 Pista: mar** ******* 30 segundos y 8944 Puntos
[01:38] LibelulaBreve 3 Pista: maria *i*e*e* 15 segundos y 8944 Puntos [01:38] LibelulaBreve
3 Pista: maria *i*e*e* 15 segundos y 8944 Puntos
[01:39] LibelulaBreve Tiempo! La respuesta es -> maria�imenez <- [01:39] LibelulaBreve
Tiempo! La respuesta es -> maria�imenez <-
[01:39] LibelulaBreve We feature over 50,000 Q&A ! [01:39] LibelulaBreve
We feature over 50,000 Q&A !
[01:39] LibelulaBreve Tri.7792 Cotilleo-TVɃarPEnTer˿(LosaSimpson-1ʃ01ytemporada)yT�loqdelhepisodioqenequebLisaqconocebaqGingivitisaMurphym?y [01:39] LibelulaBreve
Tri.7792 Cotilleo-TVɃarPEnTer˿(LosaSimpson-1ʃ01ytemporada)yT�loqdelhepisodioqenequebLisaqconocebaqGingivitisaMurphym?y
[01:39] LibelulaBreve 1 Pista: ** ***** ** ** **** **** Valor pregunta : 13379 Puntos [01:39] LibelulaBreve
1 Pista: ** ***** ** ** **** **** Valor pregunta : 13379 Puntos
[01:39] LibelulaBreve 2 Pista: el�**** ** ** **** **** 30 segundos y 13379 Puntos [01:39] LibelulaBreve
2 Pista: el�**** ** ** **** **** 30 segundos y 13379 Puntos
[01:39] LibelulaBreve 3 Pista: el�*ue* *e *a *o*a *i*a 15 segundos y 13379 Puntos [01:39] LibelulaBreve
3 Pista: el�*ue* *e *a *o*a *i*a 15 segundos y 13379 Puntos
[01:40] LibelulaBreve Tiempo! La respuesta es -> el�lues�e�a�ona�isa <- [01:40] LibelulaBreve
Tiempo! La respuesta es -> el�lues�e�a�ona�isa <-
[01:40] LibelulaBreve Tri.11146 Historiaɳubmarin˿Dondeefueederrotadoielcalmiranteegraffkvoncspee?i?i [01:40] LibelulaBreve
Tri.11146 Historiaɳubmarin˿Dondeefueederrotadoielcalmiranteegraffkvoncspee?i?i
[01:40] LibelulaBreve 1 Pista: ***** ******** Valor pregunta : 14323 Puntos [01:40] LibelulaBreve
1 Pista: ***** ******** Valor pregunta : 14323 Puntos
[01:40] LibelulaBreve 2 Pista: isl** ******** 30 segundos y 14323 Puntos [01:40] LibelulaBreve
2 Pista: isl** ******** 30 segundos y 14323 Puntos
[01:40] LibelulaBreve 3 Pista: isla* *a**i*a* 15 segundos y 14323 Puntos [01:40] LibelulaBreve
3 Pista: isla* *a**i*a* 15 segundos y 14323 Puntos
[01:40] LibelulaBreve Tiempo! La respuesta es -> islas�alvinas <- [01:40] LibelulaBreve
Tiempo! La respuesta es -> islas�alvinas <-
[01:41] LibelulaBreve Tri.10554 Eros-Sexɡkivasha˿C󭯃01nsehllamablabgrᮤulabendocrina,zentrehcuyasbm�ltiplesbfuncionesbsehencuentrablabdehregularjlasbhormonasbquehrigenwnuestrabsexualidad?z?z [01:41] LibelulaBreve
Tri.10554 Eros-Sexɡkivasha˿C󭯃01nsehllamablabgrᮤulabendocrina,zentrehcuyasbm�ltiplesbfuncionesbsehencuentrablabdehregularjlasbhormonasbquehrigenwnuestrabsexualidad?z?z
[01:41] LibelulaBreve 1 Pista: ********* Valor pregunta : 8695 Puntos [01:41] LibelulaBreve
1 Pista: ********* Valor pregunta : 8695 Puntos
[01:41] LibelulaBreve 2 Pista: hip****** 30 segundos y 8695 Puntos [01:41] LibelulaBreve
2 Pista: hip****** 30 segundos y 8695 Puntos
[01:41] LibelulaBreve 3 Pista: hipo*i*i* 15 segundos y 8695 Puntos [01:41] LibelulaBreve
3 Pista: hipo*i*i* 15 segundos y 8695 Puntos
[01:41] LibelulaBreve Tiempo! La respuesta es -> hipofisis <- [01:41] LibelulaBreve
Tiempo! La respuesta es -> hipofisis <-
[01:42] LibelulaBreve Please remember this is a FREE service, Please do not complain [01:42] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[01:42] LibelulaBreve Tri.15552 Fisica-QuimicaɈdosO˿COMOvSEvLLAMAvELvPROCESOvPORvELvCUALvSEvDIFUNDENvLIQUIDOSvOvGASESvATRAVESvDEvUNAvMEMBRANAvPERMEABLEv?v [01:42] LibelulaBreve
Tri.15552 Fisica-QuimicaɈdosO˿COMOvSEvLLAMAvELvPROCESOvPORvELvCUALvSEvDIFUNDENvLIQUIDOSvOvGASESvATRAVESvDEvUNAvMEMBRANAvPERMEABLEv?v
[01:42] LibelulaBreve 1 Pista: ******* Valor pregunta : 10435 Puntos [01:42] LibelulaBreve
1 Pista: ******* Valor pregunta : 10435 Puntos
[01:42] LibelulaBreve 2 Pista: osm**** 30 segundos y 10435 Puntos [01:42] LibelulaBreve
2 Pista: osm**** 30 segundos y 10435 Puntos
[01:42] LibelulaBreve 3 Pista: osmo*i* 15 segundos y 10435 Puntos [01:42] LibelulaBreve
3 Pista: osmo*i* 15 segundos y 10435 Puntos
[01:42] LibelulaBreve Tiempo! La respuesta es -> osmosis <- [01:42] LibelulaBreve
Tiempo! La respuesta es -> osmosis <-
[01:42] LibelulaBreve R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663 [01:42] LibelulaBreve
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663
[01:42] LibelulaBreve Tri.16076 IdiomasɎEVIVA˿Catalᮃ01n-uEspa񯬺"ETZIBAR"u?u [01:42] LibelulaBreve
Tri.16076 IdiomasɎEVIVA˿Catalᮃ01n-uEspa񯬺"ETZIBAR"u?u
[01:42] LibelulaBreve 1 Pista: ***** Valor pregunta : 5476 Puntos [01:42] LibelulaBreve
1 Pista: ***** Valor pregunta : 5476 Puntos
[01:43] LibelulaBreve 2 Pista: peg** 30 segundos y 5476 Puntos [01:43] LibelulaBreve
2 Pista: peg** 30 segundos y 5476 Puntos
[01:43] LibelulaBreve 3 Pista: pega* 15 segundos y 5476 Puntos [01:43] LibelulaBreve
3 Pista: pega* 15 segundos y 5476 Puntos
[01:43] LibelulaBreve Tiempo! La respuesta es -> pegar <- [01:43] LibelulaBreve
Tiempo! La respuesta es -> pegar <-
[01:43] LibelulaBreve If you think a Q&A is wrong, please call an OP [01:43] LibelulaBreve
If you think a Q&A is wrong, please call an OP
[01:43] LibelulaBreve Tri.8045 Politicaɩpy˿Cualgesdlapresidenciapoficialgmasdgrandeldelgmundo?q?q [01:43] LibelulaBreve
Tri.8045 Politicaɩpy˿Cualgesdlapresidenciapoficialgmasdgrandeldelgmundo?q?q
[01:43] LibelulaBreve 1 Pista: ** ******** Valor pregunta : 20507 Puntos [01:43] LibelulaBreve
1 Pista: ** ******** Valor pregunta : 20507 Puntos
[01:44] LibelulaBreve 2 Pista: el�******* 30 segundos y 20507 Puntos [01:44] LibelulaBreve
2 Pista: el�******* 30 segundos y 20507 Puntos
[01:44] LibelulaBreve 3 Pista: el�a*i*a*o 15 segundos y 20507 Puntos [01:44] LibelulaBreve
3 Pista: el�a*i*a*o 15 segundos y 20507 Puntos
[01:44] LibelulaBreve Tiempo! La respuesta es -> el�aticano <- [01:44] LibelulaBreve
Tiempo! La respuesta es -> el�aticano <-
[01:44] LibelulaBreve R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708 [01:44] LibelulaBreve
R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708
[01:44] LibelulaBreve Tri.20101 Politicaɩfen˿(siglas)hsignificadobdezUNESCOh(ingl鳩h?h [01:44] LibelulaBreve
Tri.20101 Politicaɩfen˿(siglas)hsignificadobdezUNESCOh(ingl鳩h?h
[01:44] LibelulaBreve 1 Pista: ****** ******* *********** ********** ******** ************ Valor pregunta : 9467 Puntos [01:44] LibelulaBreve
1 Pista: ****** ******* *********** ********** ******** ************ Valor pregunta : 9467 Puntos
[01:45] LibelulaBreve 2 Pista: uni*** ******* *********** ********** ******** ************ 30 segundos y 9467 Puntos [01:45] LibelulaBreve
2 Pista: uni*** ******* *********** ********** ******** ************ 30 segundos y 9467 Puntos
[01:45] LibelulaBreve 3 Pista: uni*e* *a*io** e*u*a*io*a* **ie**i*i* *u**u*a* o**a*i*a*io* 15 segundos y 9467 Puntos [01:45] LibelulaBreve
3 Pista: uni*e* *a*io** e*u*a*io*a* **ie**i*i* *u**u*a* o**a*i*a*io* 15 segundos y 9467 Puntos
[01:45] LibelulaBreve Tiempo! La respuesta es -> united�ations�ducational�cientific�ultural�rganization <- [01:45] LibelulaBreve
Tiempo! La respuesta es -> united�ations�ducational�cientific�ultural�rganization <-
[01:45] LibelulaBreve For The Competitive Edge type !pingme [01:45] LibelulaBreve
For The Competitive Edge type !pingme
[01:45] LibelulaBreve Tri.10264 Cienciaɴjmm.com˅lbinventorzdelbtelescopiofnoffuezGalileofcomofsezdicezenqotradpreguntaddezTrivial,ysezcreezquezsuoinventorzfue...y?y [01:45] LibelulaBreve
Tri.10264 Cienciaɴjmm.com˅lbinventorzdelbtelescopiofnoffuezGalileofcomofsezdicezenqotradpreguntaddezTrivial,ysezcreezquezsuoinventorzfue...y?y
[01:45] LibelulaBreve 1 Pista: **** ********** Valor pregunta : 14747 Puntos [01:45] LibelulaBreve
1 Pista: **** ********** Valor pregunta : 14747 Puntos
[01:45] LibelulaBreve 2 Pista: han* ********** 30 segundos y 14747 Puntos [01:45] LibelulaBreve
2 Pista: han* ********** 30 segundos y 14747 Puntos
[01:46] Ardilla_Transparente DJ "Serena" cierra peticiones [01:46] Ardilla_Transparente
DJ "Serena" cierra peticiones
[01:46] LibelulaBreve 3 Pista: han* *i**e***e* 15 segundos y 14747 Puntos [01:46] LibelulaBreve
3 Pista: han* *i**e***e* 15 segundos y 14747 Puntos
[01:46] LibelulaBreve Tiempo! La respuesta es -> hans�ippershey <- [01:46] LibelulaBreve
Tiempo! La respuesta es -> hans�ippershey <-
[01:46] LibelulaBreve Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [01:46] LibelulaBreve
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[01:46] LibelulaBreve Tri.19140 Cienciaɳtephenwo˿C󭯃01lsepllamatatlataplicaci󮃰1vdeplatcienciatenvelssectorjindustrial?w?w [01:46] LibelulaBreve
Tri.19140 Cienciaɳtephenwo˿C󭯃01lsepllamatatlataplicaci󮃰1vdeplatcienciatenvelssectorjindustrial?w?w
[01:46] LibelulaBreve 1 Pista: ******* Valor pregunta : 20060 Puntos [01:46] LibelulaBreve
1 Pista: ******* Valor pregunta : 20060 Puntos
[01:46] LibelulaBreve 2 Pista: tec**** 30 segundos y 20060 Puntos [01:46] LibelulaBreve
2 Pista: tec**** 30 segundos y 20060 Puntos
[01:47] LibelulaBreve 3 Pista: tec*i*a 15 segundos y 20060 Puntos [01:47] LibelulaBreve
3 Pista: tec*i*a 15 segundos y 20060 Puntos
[01:47] LibelulaBreve Tiempo! La respuesta es -> tecnica <- [01:47] LibelulaBreve
Tiempo! La respuesta es -> tecnica <-
[01:47] LibelulaBreve R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: NN_vOx_Bukelizacion-YA 839312 #9: NN_vOx_Infierno-Fiscal 407404 #10: kitana_- 299678 [01:47] LibelulaBreve
R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: NN_vOx_Bukelizacion-YA 839312 #9: NN_vOx_Infierno-Fiscal 407404 #10: kitana_- 299678
[01:47] LibelulaBreve Tri.2938 Geografiaɓebosin˿Cuᬃ01iesxeliactualinombreudeulavciudadadeuAngora?r?r [01:47] LibelulaBreve
Tri.2938 Geografiaɓebosin˿Cuᬃ01iesxeliactualinombreudeulavciudadadeuAngora?r?r
[01:47] LibelulaBreve 1 Pista: ****** Valor pregunta : 6749 Puntos [01:47] LibelulaBreve
1 Pista: ****** Valor pregunta : 6749 Puntos
[01:47] LibelulaBreve 2 Pista: ank*** 30 segundos y 6749 Puntos [01:47] LibelulaBreve
2 Pista: ank*** 30 segundos y 6749 Puntos
[01:48] LibelulaBreve 3 Pista: anka*a 15 segundos y 6749 Puntos [01:48] LibelulaBreve
3 Pista: anka*a 15 segundos y 6749 Puntos
[01:48] LibelulaBreve Tiempo! La respuesta es -> ankara <- [01:48] LibelulaBreve
Tiempo! La respuesta es -> ankara <-
[01:48] LibelulaBreve Please refrain from using Extreme Bad Language [01:48] LibelulaBreve
Please refrain from using Extreme Bad Language
[01:48] LibelulaBreve Tri.17629 Arteɖivi˿Anqu郰1ncivilizaci󮃰1kpertenecenklosnanfiteatros?n?n [01:48] LibelulaBreve
Tri.17629 Arteɖivi˿Anqu郰1ncivilizaci󮃰1kpertenecenklosnanfiteatros?n?n
[01:48] LibelulaBreve 1 Pista: ****** Valor pregunta : 5434 Puntos [01:48] LibelulaBreve
1 Pista: ****** Valor pregunta : 5434 Puntos
[01:48] LibelulaBreve 2 Pista: rom*** 30 segundos y 5434 Puntos [01:48] LibelulaBreve
2 Pista: rom*** 30 segundos y 5434 Puntos
[01:49] LibelulaBreve 3 Pista: roma*a 15 segundos y 5434 Puntos [01:49] LibelulaBreve
3 Pista: roma*a 15 segundos y 5434 Puntos
[01:49] LibelulaBreve Tiempo! La respuesta es -> romana <- [01:49] LibelulaBreve
Tiempo! La respuesta es -> romana <-
[01:49] LibelulaBreve This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve [01:49] LibelulaBreve
This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve
[01:49] LibelulaBreve Tri.10208 MiscelaneaɔeLaRaNhA˿Delquienuselausentoy?o [01:49] LibelulaBreve
Tri.10208 MiscelaneaɔeLaRaNhA˿Delquienuselausentoy?o
[01:49] LibelulaBreve 1 Pista: ******* ****** *** ** ***** Valor pregunta : 5765 Puntos [01:49] LibelulaBreve
1 Pista: ******* ****** *** ** ***** Valor pregunta : 5765 Puntos
[01:49] LibelulaBreve 2 Pista: hac**** ****** *** ** ***** 30 segundos y 5765 Puntos [01:49] LibelulaBreve
2 Pista: hac**** ****** *** ** ***** 30 segundos y 5765 Puntos
[01:49] LibelulaBreve 3 Pista: hace*o* *ue**a *ue *e *u*io 15 segundos y 5765 Puntos [01:49] LibelulaBreve
3 Pista: hace*o* *ue**a *ue *e *u*io 15 segundos y 5765 Puntos
[01:50] LibelulaBreve Tiempo! La respuesta es -> hacemos�uenta�ue�e�urio <- [01:50] LibelulaBreve
Tiempo! La respuesta es -> hacemos�uenta�ue�e�urio <-
[01:50] LibelulaBreve This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [01:50] LibelulaBreve
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[01:50] LibelulaBreve Tri.8469 MitologiaɍARdeJAVA˿AvQUɃ01vMITOLOǴvPERTENECEvELv�BOLvDELvUNIVERSOvYGGDRASIL?v?v [01:50] LibelulaBreve
Tri.8469 MitologiaɍARdeJAVA˿AvQUɃ01vMITOLOǴvPERTENECEvELv�BOLvDELvUNIVERSOvYGGDRASIL?v?v
[01:50] LibelulaBreve 1 Pista: *********** Valor pregunta : 15820 Puntos [01:50] LibelulaBreve
1 Pista: *********** Valor pregunta : 15820 Puntos
[01:50] LibelulaBreve 2 Pista: esc******** 30 segundos y 15820 Puntos [01:50] LibelulaBreve
2 Pista: esc******** 30 segundos y 15820 Puntos
[01:50] LibelulaBreve 3 Pista: esca**i*a*a 15 segundos y 15820 Puntos [01:50] LibelulaBreve
3 Pista: esca**i*a*a 15 segundos y 15820 Puntos
[01:51] LibelulaBreve �Absolutamente correcto Gata_Suave!! Acertaste "escandinava" en �3.891 segundos y ganas �5820�12 puntos [01:51] LibelulaBreve
�Absolutamente correcto Gata_Suave!! Acertaste "escandinava" en �3.891 segundos y ganas �5820�12 puntos
[01:51] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [01:51] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[01:51] LibelulaBreve Gata_Suave has acertado 5 seguidas!! Puntos HOY: 272395, SEMANA: 272395 y MES: 272395 [01:51] LibelulaBreve
Gata_Suave has acertado 5 seguidas!! Puntos HOY: 272395, SEMANA: 272395 y MES: 272395
[01:51] Gata_Suave escandinava [01:51] Gata_Suave
escandinava
[01:51] LibelulaBreve Please remember this is a FREE service, Please do not complain [01:51] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[01:51] LibelulaBreve Tri.6669 Cotilleo-TVɍARdeJAVA˿CӍOcSEcLLAMAcLAcHIJAcDEcMELANIEcGRIFFITHcQUEcTIENEcNOMBREcDEcESTADOcNORTEAMERICANO?c?c [01:51] LibelulaBreve
Tri.6669 Cotilleo-TVɍARdeJAVA˿CӍOcSEcLLAMAcLAcHIJAcDEcMELANIEcGRIFFITHcQUEcTIENEcNOMBREcDEcESTADOcNORTEAMERICANO?c?c
[01:51] LibelulaBreve 1 Pista: ****** Valor pregunta : 16664 Puntos [01:51] LibelulaBreve
1 Pista: ****** Valor pregunta : 16664 Puntos
[01:51] LibelulaBreve 2 Pista: dak*** 30 segundos y 16664 Puntos [01:51] LibelulaBreve
2 Pista: dak*** 30 segundos y 16664 Puntos
[01:51] Gata_Suave dakota [01:51] Gata_Suave
dakota
[01:51] LibelulaBreve �Bingo!! Gata_Suave dio la respuesta: "dakota" en �0.422 segundos e incrementa sus ganancias con �6664�12 puntos [01:51] LibelulaBreve
�Bingo!! Gata_Suave dio la respuesta: "dakota" en �0.422 segundos e incrementa sus ganancias con �6664�12 puntos
[01:51] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [01:51] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[01:51] LibelulaBreve Gata_Suave has acertado 6 seguidas!! Puntos HOY: 289059, SEMANA: 289059 y MES: 289059 [01:51] LibelulaBreve
Gata_Suave has acertado 6 seguidas!! Puntos HOY: 289059, SEMANA: 289059 y MES: 289059
[01:51] LibelulaBreve This MONTHS Top 11-20: - #11: Guerrero08 297002 #12: KaZuMa_KiRyU 258500 #13: Gata_Suave 256575 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 69726 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065 [01:51] LibelulaBreve
This MONTHS Top 11-20: - #11: Guerrero08 297002 #12: KaZuMa_KiRyU 258500 #13: Gata_Suave 256575 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 69726 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065
[01:51] LibelulaBreve Tri.11904 ArteɂRUJI˿DEgQUIENgESgLAgOBRAg"PINTURAgCONgBORDEgBLANCO"g(1913)g?g [01:51] LibelulaBreve
Tri.11904 ArteɂRUJI˿DEgQUIENgESgLAgOBRAg"PINTURAgCONgBORDEgBLANCO"g(1913)g?g
[01:51] LibelulaBreve 1 Pista: ********* Valor pregunta : 21955 Puntos [01:51] LibelulaBreve
1 Pista: ********* Valor pregunta : 21955 Puntos
[01:52] LibelulaBreve 2 Pista: kan****** 30 segundos y 21955 Puntos [01:52] LibelulaBreve
2 Pista: kan****** 30 segundos y 21955 Puntos
[01:52] LibelulaBreve 3 Pista: kan*i**** 15 segundos y 21955 Puntos [01:52] LibelulaBreve
3 Pista: kan*i**** 15 segundos y 21955 Puntos
[01:52] LibelulaBreve Tiempo! La respuesta es -> kandinsky <- [01:52] LibelulaBreve
Tiempo! La respuesta es -> kandinsky <-
[01:52] LibelulaBreve R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 [01:52] LibelulaBreve
R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244
[01:52] LibelulaBreve Tri.15985 DeporteɔeLaRaNhA˿Jugadoryestrellahdeflahselecci󮃰1despa񯬡hdefBaloncestoqendIndianᰯlisc2002a?a [01:52] LibelulaBreve
Tri.15985 DeporteɔeLaRaNhA˿Jugadoryestrellahdeflahselecci󮃰1despa񯬡hdefBaloncestoqendIndianᰯlisc2002a?a
[01:52] LibelulaBreve 1 Pista: *** ***** Valor pregunta : 19307 Puntos [01:52] LibelulaBreve
1 Pista: *** ***** Valor pregunta : 19307 Puntos
[01:52] LibelulaBreve 2 Pista: pau ***** 30 segundos y 19307 Puntos [01:52] LibelulaBreve
2 Pista: pau ***** 30 segundos y 19307 Puntos
[01:53] LibelulaBreve 3 Pista: pau *a*o* 15 segundos y 19307 Puntos [01:53] LibelulaBreve
3 Pista: pau *a*o* 15 segundos y 19307 Puntos
[01:53] LibelulaBreve Tiempo! La respuesta es -> pau�asol <- [01:53] LibelulaBreve
Tiempo! La respuesta es -> pau�asol <-
[01:53] LibelulaBreve Top10 Players ( Weekly & Monthly ) are Auto-Voiced [01:53] LibelulaBreve
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[01:53] LibelulaBreve Tri.4788 PoliticaɊAVEA˿DEmQUEmESTADOmDEmEE.UUmFUEmGOBERNADORmENTREm1966mYm1974,mRONALDmREAGANm?m [01:53] LibelulaBreve
Tri.4788 PoliticaɊAVEA˿DEmQUEmESTADOmDEmEE.UUmFUEmGOBERNADORmENTREm1966mYm1974,mRONALDmREAGANm?m
[01:53] LibelulaBreve 1 Pista: ********** Valor pregunta : 23467 Puntos [01:53] LibelulaBreve
1 Pista: ********** Valor pregunta : 23467 Puntos
[01:53] LibelulaBreve 2 Pista: cal******* 30 segundos y 23467 Puntos [01:53] LibelulaBreve
2 Pista: cal******* 30 segundos y 23467 Puntos
[01:54] Gata_Suave california [01:54] Gata_Suave
california
[01:54] LibelulaBreve �emuestra lo que sabes Gata_Suave! Has respondido "california" correctamente y eso te da: �3467�12 puntos [01:54] LibelulaBreve
�emuestra lo que sabes Gata_Suave! Has respondido "california" correctamente y eso te da: �3467�12 puntos
[01:54] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [01:54] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[01:54] LibelulaBreve Gata_Suave has acertado 7 seguidas!! Puntos HOY: 312526, SEMANA: 312526 y MES: 312526 [01:54] LibelulaBreve
Gata_Suave has acertado 7 seguidas!! Puntos HOY: 312526, SEMANA: 312526 y MES: 312526
[01:54] LibelulaBreve Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [01:54] LibelulaBreve
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[01:54] LibelulaBreve Tri.9665 PersonajesɍARdeJAVA˿CU�fESfELfSIGNOfDELfZODIACOfDEfLOSfSIGUIENTESfPERSONAJESfCɌEBRES:fCLINTfEASTWOOD,fANAfBELɎ,fPAULfMCCARTNEYfYfJORDIfPUJOL?f?f [01:54] LibelulaBreve
Tri.9665 PersonajesɍARdeJAVA˿CU�fESfELfSIGNOfDELfZODIACOfDEfLOSfSIGUIENTESfPERSONAJESfCɌEBRES:fCLINTfEASTWOOD,fANAfBELɎ,fPAULfMCCARTNEYfYfJORDIfPUJOL?f?f
[01:54] LibelulaBreve 1 Pista: ******* Valor pregunta : 17612 Puntos [01:54] LibelulaBreve
1 Pista: ******* Valor pregunta : 17612 Puntos
[01:54] LibelulaBreve 2 Pista: gem**** 30 segundos y 17612 Puntos [01:54] LibelulaBreve
2 Pista: gem**** 30 segundos y 17612 Puntos
[01:54] LibelulaBreve �Absolutamente correcto Gata_Suave!! Acertaste "geminis" en �4.532 segundos y ganas �7612�12 puntos [01:54] LibelulaBreve
�Absolutamente correcto Gata_Suave!! Acertaste "geminis" en �4.532 segundos y ganas �7612�12 puntos
[01:54] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [01:54] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[01:54] LibelulaBreve Gata_Suave has acertado 8 seguidas!! Puntos HOY: 330138, SEMANA: 330138 y MES: 330138 [01:54] LibelulaBreve
Gata_Suave has acertado 8 seguidas!! Puntos HOY: 330138, SEMANA: 330138 y MES: 330138
[01:54] Gata_Suave geminis [01:54] Gata_Suave
geminis
[01:54] LibelulaBreve Tri.8417 Fisica-Quimicaɘove˿Cuᬃ01jesolajunidadmdesmedidajdeslajenergiajoatrabajoa?v [01:54] LibelulaBreve
Tri.8417 Fisica-Quimicaɘove˿Cuᬃ01jesolajunidadmdesmedidajdeslajenergiajoatrabajoa?v
[01:54] LibelulaBreve 1 Pista: ***** Valor pregunta : 9004 Puntos [01:54] LibelulaBreve
1 Pista: ***** Valor pregunta : 9004 Puntos
[01:55] LibelulaBreve 2 Pista: erg** 30 segundos y 9004 Puntos [01:55] LibelulaBreve
2 Pista: erg** 30 segundos y 9004 Puntos
[01:55] Gata_Suave ergon [01:55] Gata_Suave
ergon
[01:55] LibelulaBreve 3 Pista: ergio 15 segundos y 9004 Puntos [01:55] LibelulaBreve
3 Pista: ergio 15 segundos y 9004 Puntos
[01:55] LibelulaBreve �Increible!! Gata_Suave contest󺠃04"ergio" en �2.969 segundos, y ha ganado �004�12 puntos [01:55] LibelulaBreve
�Increible!! Gata_Suave contest󺠃04"ergio" en �2.969 segundos, y ha ganado �004�12 puntos
[01:55] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [01:55] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[01:55] LibelulaBreve Gata_Suave has acertado 9 seguidas!! Puntos HOY: 339142, SEMANA: 339142 y MES: 339142 [01:55] LibelulaBreve
Gata_Suave has acertado 9 seguidas!! Puntos HOY: 339142, SEMANA: 339142 y MES: 339142
[01:55] Gata_Suave ergio [01:55] Gata_Suave
ergio
[01:55] LibelulaBreve We feature over 50,000 Q&A ! [01:55] LibelulaBreve
We feature over 50,000 Q&A !
[01:55] LibelulaBreve Tri.1187 LiteraturaɎefthis˿AutorbdeoLatTabernat?y [01:55] LibelulaBreve
Tri.1187 LiteraturaɎefthis˿AutorbdeoLatTabernat?y
[01:55] LibelulaBreve 1 Pista: ***** **** Valor pregunta : 24334 Puntos [01:55] LibelulaBreve
1 Pista: ***** **** Valor pregunta : 24334 Puntos
[01:55] LibelulaBreve 2 Pista: Emi** **** 30 segundos y 24334 Puntos [01:55] LibelulaBreve
2 Pista: Emi** **** 30 segundos y 24334 Puntos
[01:55] LibelulaBreve 3 Pista: Emi*e *o*a 15 segundos y 24334 Puntos [01:55] LibelulaBreve
3 Pista: Emi*e *o*a 15 segundos y 24334 Puntos
[01:56] LibelulaBreve Tiempo! La respuesta es -> Emile�ola <- [01:56] LibelulaBreve
Tiempo! La respuesta es -> Emile�ola <-
[01:56] LibelulaBreve Tri.11509 Idiomasɐsico666˥spa񯬭catalan:njuegol?n [01:56] LibelulaBreve
Tri.11509 Idiomasɐsico666˥spa񯬭catalan:njuegol?n
[01:56] LibelulaBreve 1 Pista: *** Valor pregunta : 22992 Puntos [01:56] LibelulaBreve
1 Pista: *** Valor pregunta : 22992 Puntos
[01:56] LibelulaBreve 2 Pista: joc 30 segundos y 22992 Puntos [01:56] LibelulaBreve
2 Pista: joc 30 segundos y 22992 Puntos
[01:56] Gata_Suave joc [01:56] Gata_Suave
joc
[01:56] LibelulaBreve �Bingo!! Gata_Suave dio la respuesta: "joc" en �0.015 segundos e incrementa sus ganancias con �2992�12 puntos [01:56] LibelulaBreve
�Bingo!! Gata_Suave dio la respuesta: "joc" en �0.015 segundos e incrementa sus ganancias con �2992�12 puntos
[01:56] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [01:56] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[01:56] LibelulaBreve Gata_Suave has acertado 10 seguidas!! Puntos HOY: 362134, SEMANA: 362134 y MES: 362134 [01:56] LibelulaBreve
Gata_Suave has acertado 10 seguidas!! Puntos HOY: 362134, SEMANA: 362134 y MES: 362134
[01:56] LibelulaBreve Bonus especial de 50000 Puntos para Gata_Suave por acertar 10 seguidas!!! [01:56] LibelulaBreve
Bonus especial de 50000 Puntos para Gata_Suave por acertar 10 seguidas!!!
[01:56] LibelulaBreve Tri.4822 Miscelaneaɓebosin˿(Religi󮩃󭯃01tseblebllamaoalareligiosotdeblaoordenzmon᳴icaofundadaoporfSanzRomualdotenzelasiglotXI?q?q [01:56] LibelulaBreve
Tri.4822 Miscelaneaɓebosin˿(Religi󮩃󭯃01tseblebllamaoalareligiosotdeblaoordenzmon᳴icaofundadaoporfSanzRomualdotenzelasiglotXI?q?q
[01:56] LibelulaBreve 1 Pista: ************ Valor pregunta : 11280 Puntos [01:56] LibelulaBreve
1 Pista: ************ Valor pregunta : 11280 Puntos
[01:57] LibelulaBreve 2 Pista: cam********* 30 segundos y 11280 Puntos [01:57] LibelulaBreve
2 Pista: cam********* 30 segundos y 11280 Puntos
[01:57] LibelulaBreve 3 Pista: cama**u*e**e 15 segundos y 11280 Puntos [01:57] LibelulaBreve
3 Pista: cama**u*e**e 15 segundos y 11280 Puntos
[01:57] LibelulaBreve Tiempo! La respuesta es -> camaldulense <- [01:57] LibelulaBreve
Tiempo! La respuesta es -> camaldulense <-
[01:57] LibelulaBreve Please remember this is a FREE service, Please do not complain [01:57] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[01:57] LibelulaBreve Tri.16798 Medicina-Saludɤassler˿C󭯃01csejllamaylayinflamaci󮃰1idejlaymucosayrectalydebidocayunaybacteriayocunivirus?x?x [01:57] LibelulaBreve
Tri.16798 Medicina-Saludɤassler˿C󭯃01csejllamaylayinflamaci󮃰1idejlaymucosayrectalydebidocayunaybacteriayocunivirus?x?x
[01:57] LibelulaBreve 1 Pista: ********* Valor pregunta : 11595 Puntos [01:57] LibelulaBreve
1 Pista: ********* Valor pregunta : 11595 Puntos
[01:58] LibelulaBreve 2 Pista: pro****** 30 segundos y 11595 Puntos [01:58] LibelulaBreve
2 Pista: pro****** 30 segundos y 11595 Puntos
[01:58] LibelulaBreve 3 Pista: pro**i*i* 15 segundos y 11595 Puntos [01:58] LibelulaBreve
3 Pista: pro**i*i* 15 segundos y 11595 Puntos
[01:58] LibelulaBreve �Est᳠que lo tiras Gata_Suave!! ߃󭯠supiste que "proctitis" era la respuesta? Venga, �1595�12 puntos suben a tu marcador [01:58] LibelulaBreve
�Est᳠que lo tiras Gata_Suave!! ߃󭯠supiste que "proctitis" era la respuesta? Venga, �1595�12 puntos suben a tu marcador
[01:58] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [01:58] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[01:58] LibelulaBreve Gata_Suave has acertado 11 seguidas!! Puntos HOY: 423729, SEMANA: 423729 y MES: 423729 [01:58] LibelulaBreve
Gata_Suave has acertado 11 seguidas!! Puntos HOY: 423729, SEMANA: 423729 y MES: 423729
[01:58] Gata_Suave proctitis [01:58] Gata_Suave
proctitis
[01:58] LibelulaBreve R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663 [01:58] LibelulaBreve
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663
[01:58] LibelulaBreve Tri.3168 Miscelaneaɓebosin˿Cuᬃ01meswelmgentilicioedesloswhabitanteswdeslawARCADIAr(Grecia)?r?r [01:58] LibelulaBreve
Tri.3168 Miscelaneaɓebosin˿Cuᬃ01meswelmgentilicioedesloswhabitanteswdeslawARCADIAr(Grecia)?r?r
[01:58] LibelulaBreve 1 Pista: ******* Pregunta de BONUS : 50000 Puntos [01:58] LibelulaBreve
1 Pista: ******* Pregunta de BONUS : 50000 Puntos
[01:58] LibelulaBreve 2 Pista: arc**** 30 segundos y 50000 Puntos [01:58] LibelulaBreve
2 Pista: arc**** 30 segundos y 50000 Puntos
[01:59] LibelulaBreve 3 Pista: arca*e* 15 segundos y 50000 Puntos [01:59] LibelulaBreve
3 Pista: arca*e* 15 segundos y 50000 Puntos
[01:59] LibelulaBreve Tiempo! La respuesta es -> arcades <- [01:59] LibelulaBreve
Tiempo! La respuesta es -> arcades <-
[01:59] LibelulaBreve If you think a Q&A is wrong, please call an OP [01:59] LibelulaBreve
If you think a Q&A is wrong, please call an OP
[01:59] LibelulaBreve Tri.10104 ArteɁWELETE˿LAnCUEVAnDEnLOSnCASARES,nCONnPINTURASnRUPESTRESnESTAnENnLAnPROVINCIAnDEn?n [01:59] LibelulaBreve
Tri.10104 ArteɁWELETE˿LAnCUEVAnDEnLOSnCASARES,nCONnPINTURASnRUPESTRESnESTAnENnLAnPROVINCIAnDEn?n
[01:59] LibelulaBreve 1 Pista: *********** Pregunta de BONUS : 25000 Puntos [01:59] LibelulaBreve
1 Pista: *********** Pregunta de BONUS : 25000 Puntos
[01:59] LibelulaBreve 2 Pista: gua******** 30 segundos y 25000 Puntos [01:59] LibelulaBreve
2 Pista: gua******** 30 segundos y 25000 Puntos
[01:59] LibelulaBreve �emuestra lo que sabes Gata_Suave! Has respondido "guadalajara" correctamente y eso te da: �5000�12 puntos [01:59] LibelulaBreve
�emuestra lo que sabes Gata_Suave! Has respondido "guadalajara" correctamente y eso te da: �5000�12 puntos
[01:59] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [01:59] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[01:59] LibelulaBreve Gata_Suave has acertado 12 seguidas!! Puntos HOY: 448729, SEMANA: 448729 y MES: 448729 [01:59] LibelulaBreve
Gata_Suave has acertado 12 seguidas!! Puntos HOY: 448729, SEMANA: 448729 y MES: 448729
[01:59] Gata_Suave guadalajara [01:59] Gata_Suave
guadalajara
[02:00] LibelulaBreve R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708 [02:00] LibelulaBreve
R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708
[02:00] LibelulaBreve Tri.10900 Deporteɳherif˿(Futbol)t߃ualnfuegelnultimomequipomenlelnquegmilitomelnToromAcu񡃰1manteskdegincorporarsegamlamLigamespa񯬡?t?t [02:00] LibelulaBreve
Tri.10900 Deporteɳherif˿(Futbol)t߃ualnfuegelnultimomequipomenlelnquegmilitomelnToromAcu񡃰1manteskdegincorporarsegamlamLigamespa񯬡?t?t
[02:00] LibelulaBreve 1 Pista: ************* Valor pregunta : 11377 Puntos [02:00] LibelulaBreve
1 Pista: ************* Valor pregunta : 11377 Puntos
[02:00] LibelulaBreve 2 Pista: ind********** 30 segundos y 11377 Puntos [02:00] LibelulaBreve
2 Pista: ind********** 30 segundos y 11377 Puntos
[02:00] LibelulaBreve 3 Pista: inde*e**ie**e 15 segundos y 11377 Puntos [02:00] LibelulaBreve
3 Pista: inde*e**ie**e 15 segundos y 11377 Puntos
[02:00] Gata_Suave independiente [02:00] Gata_Suave
independiente
[02:00] LibelulaBreve �Eso es Gata_Suave!! Dijiste: "independiente" y ello te ha valido: �1377�12 puntos [02:00] LibelulaBreve
�Eso es Gata_Suave!! Dijiste: "independiente" y ello te ha valido: �1377�12 puntos
[02:00] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:00] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:00] LibelulaBreve Gata_Suave has acertado 13 seguidas!! Puntos HOY: 460106, SEMANA: 460106 y MES: 460106 [02:00] LibelulaBreve
Gata_Suave has acertado 13 seguidas!! Puntos HOY: 460106, SEMANA: 460106 y MES: 460106
[02:00] LibelulaBreve For The Competitive Edge type !pingme [02:00] LibelulaBreve
For The Competitive Edge type !pingme
[02:00] LibelulaBreve Tri.14119 Deporteə�l˿Entqu郰1xequipohuniversitariohjug󃰱x"Magic"xJonhson?x?x [02:00] LibelulaBreve
Tri.14119 Deporteə�l˿Entqu郰1xequipohuniversitariohjug󃰱x"Magic"xJonhson?x?x
[02:00] LibelulaBreve 1 Pista: ******** ***** Valor pregunta : 11032 Puntos [02:00] LibelulaBreve
1 Pista: ******** ***** Valor pregunta : 11032 Puntos
[02:01] LibelulaBreve 2 Pista: mic***** ***** 30 segundos y 11032 Puntos [02:01] LibelulaBreve
2 Pista: mic***** ***** 30 segundos y 11032 Puntos
[02:01] LibelulaBreve 3 Pista: mic*i*a* **a*e 15 segundos y 11032 Puntos [02:01] LibelulaBreve
3 Pista: mic*i*a* **a*e 15 segundos y 11032 Puntos
[02:01] LibelulaBreve Tiempo! La respuesta es -> michigan�tate <- [02:01] LibelulaBreve
Tiempo! La respuesta es -> michigan�tate <-
[02:01] Gata_Suave jajaja [02:01] Gata_Suave
jajaja
[02:01] LibelulaBreve Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [02:01] LibelulaBreve
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[02:01] LibelulaBreve Tri.3671 BiologiaɍARdeJAVA˿CONdQUɃ01dPEZdSEdSUELEdCONFUNDIRdELdABADEJOdDEBIDOdAdSUdGRANdPARECIDO?d?d [02:01] LibelulaBreve
Tri.3671 BiologiaɍARdeJAVA˿CONdQUɃ01dPEZdSEdSUELEdCONFUNDIRdELdABADEJOdDEBIDOdAdSUdGRANdPARECIDO?d?d
[02:01] LibelulaBreve 1 Pista: ******* Valor pregunta : 7371 Puntos [02:01] LibelulaBreve
1 Pista: ******* Valor pregunta : 7371 Puntos
[02:02] LibelulaBreve 2 Pista: bac**** 30 segundos y 7371 Puntos [02:02] LibelulaBreve
2 Pista: bac**** 30 segundos y 7371 Puntos
[02:02] LibelulaBreve 3 Pista: baca*ao 15 segundos y 7371 Puntos [02:02] LibelulaBreve
3 Pista: baca*ao 15 segundos y 7371 Puntos
[02:02] LibelulaBreve Tiempo! La respuesta es -> bacalao <- [02:02] LibelulaBreve
Tiempo! La respuesta es -> bacalao <-
[02:02] LibelulaBreve R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: NN_vOx_Bukelizacion-YA 839312 #9: Gata_Suave 460106 #10: NN_vOx_Infierno-Fiscal 407404 [02:02] LibelulaBreve
R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: NN_vOx_Bukelizacion-YA 839312 #9: Gata_Suave 460106 #10: NN_vOx_Infierno-Fiscal 407404
[02:02] LibelulaBreve Tri.5501 Politicaɭ˿Delqu郰1fpa�01vfuelprimergministrorDubcekp?f [02:02] LibelulaBreve
Tri.5501 Politicaɭ˿Delqu郰1fpa�01vfuelprimergministrorDubcekp?f
[02:02] LibelulaBreve 1 Pista: ************** Valor pregunta : 19950 Puntos [02:02] LibelulaBreve
1 Pista: ************** Valor pregunta : 19950 Puntos
[02:02] LibelulaBreve 2 Pista: che*********** 30 segundos y 19950 Puntos [02:02] LibelulaBreve
2 Pista: che*********** 30 segundos y 19950 Puntos
[02:03] Gata_Suave checoslovaquia [02:03] Gata_Suave
checoslovaquia
[02:03] LibelulaBreve �e nota que sabes mucho de esto Gata_Suave! Tu respuesta "checoslovaquia" es correcta y ganas �9950�12 puntos [02:03] LibelulaBreve
�e nota que sabes mucho de esto Gata_Suave! Tu respuesta "checoslovaquia" es correcta y ganas �9950�12 puntos
[02:03] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:03] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:03] LibelulaBreve Gata_Suave has acertado 14 seguidas!! Puntos HOY: 480056, SEMANA: 480056 y MES: 480056 [02:03] LibelulaBreve
Gata_Suave has acertado 14 seguidas!! Puntos HOY: 480056, SEMANA: 480056 y MES: 480056
[02:03] LibelulaBreve Please refrain from using Extreme Bad Language [02:03] LibelulaBreve
Please refrain from using Extreme Bad Language
[02:03] LibelulaBreve Tri.11520 Musicaɬusie˱717-1757),rcompositorkalemᮃ01ndeliBarrocodtard�rintroduciendodennsuhc鬥breiorquestaedeiMannheimxlaenovedadwsensacionalidelicrescendodyudiminuendod?r [02:03] LibelulaBreve
Tri.11520 Musicaɬusie˱717-1757),rcompositorkalemᮃ01ndeliBarrocodtard�rintroduciendodennsuhc鬥breiorquestaedeiMannheimxlaenovedadwsensacionalidelicrescendodyudiminuendod?r
[02:03] LibelulaBreve 1 Pista: ****** ******* Valor pregunta : 8040 Puntos [02:03] LibelulaBreve
1 Pista: ****** ******* Valor pregunta : 8040 Puntos
[02:03] LibelulaBreve 2 Pista: joh*** ******* 30 segundos y 8040 Puntos [02:03] LibelulaBreve
2 Pista: joh*** ******* 30 segundos y 8040 Puntos
[02:03] LibelulaBreve 3 Pista: joha** **a*i** 15 segundos y 8040 Puntos [02:03] LibelulaBreve
3 Pista: joha** **a*i** 15 segundos y 8040 Puntos
[02:03] LibelulaBreve Tiempo! La respuesta es -> johann�tamitz <- [02:03] LibelulaBreve
Tiempo! La respuesta es -> johann�tamitz <-
[02:04] LibelulaBreve This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve [02:04] LibelulaBreve
This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve
[02:04] LibelulaBreve Tri.2304 Mitologiaɤassler˿C󭯃01hsepllamakelydiosnhititakqueppresideplakprimerakgeneraci󮃰1mceleste?q?q [02:04] LibelulaBreve
Tri.2304 Mitologiaɤassler˿C󭯃01hsepllamakelydiosnhititakqueppresideplakprimerakgeneraci󮃰1mceleste?q?q
[02:04] LibelulaBreve 1 Pista: ***** Valor pregunta : 17792 Puntos [02:04] LibelulaBreve
1 Pista: ***** Valor pregunta : 17792 Puntos
[02:04] LibelulaBreve 2 Pista: ala** 30 segundos y 17792 Puntos [02:04] LibelulaBreve
2 Pista: ala** 30 segundos y 17792 Puntos
[02:04] LibelulaBreve 3 Pista: ala*u 15 segundos y 17792 Puntos [02:04] LibelulaBreve
3 Pista: ala*u 15 segundos y 17792 Puntos
[02:04] LibelulaBreve Tiempo! La respuesta es -> alalu <- [02:04] LibelulaBreve
Tiempo! La respuesta es -> alalu <-
[02:05] LibelulaBreve This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [02:05] LibelulaBreve
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[02:05] LibelulaBreve Tri.10467 ArteɓHeLeNe˿DEhQUeaESTILOharquitect󮩣oxEShELhMONASTERIOhELhESCODIALh?h [02:05] LibelulaBreve
Tri.10467 ArteɓHeLeNe˿DEhQUeaESTILOharquitect󮩣oxEShELhMONASTERIOhELhESCODIALh?h
[02:05] LibelulaBreve 1 Pista: ********** Valor pregunta : 21443 Puntos [02:05] LibelulaBreve
1 Pista: ********** Valor pregunta : 21443 Puntos
[02:05] LibelulaBreve 2 Pista: her******* 30 segundos y 21443 Puntos [02:05] LibelulaBreve
2 Pista: her******* 30 segundos y 21443 Puntos
[02:05] LibelulaBreve 3 Pista: her*e*ia*o 15 segundos y 21443 Puntos [02:05] LibelulaBreve
3 Pista: her*e*ia*o 15 segundos y 21443 Puntos
[02:05] LibelulaBreve Tiempo! La respuesta es -> herreriano <- [02:05] LibelulaBreve
Tiempo! La respuesta es -> herreriano <-
[02:05] LibelulaBreve Please remember this is a FREE service, Please do not complain [02:05] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[02:06] LibelulaBreve Tri.8354 Medicina-Saludɍissifux˿Denominaci󮃰1fqueerecibeeelecueroccabelludoccompleto,xincluidosbladpiel,xlasbhojasbmuscularesbyalasbaponeurosisb?x [02:06] LibelulaBreve
Tri.8354 Medicina-Saludɍissifux˿Denominaci󮃰1fqueerecibeeelecueroccabelludoccompleto,xincluidosbladpiel,xlasbhojasbmuscularesbyalasbaponeurosisb?x
[02:06] LibelulaBreve 1 Pista: ********* Valor pregunta : 20868 Puntos [02:06] LibelulaBreve
1 Pista: ********* Valor pregunta : 20868 Puntos
[02:06] LibelulaBreve 2 Pista: epi****** 30 segundos y 20868 Puntos [02:06] LibelulaBreve
2 Pista: epi****** 30 segundos y 20868 Puntos
[02:06] LibelulaBreve 3 Pista: epi**a*eo 15 segundos y 20868 Puntos [02:06] LibelulaBreve
3 Pista: epi**a*eo 15 segundos y 20868 Puntos
[02:06] LibelulaBreve Tiempo! La respuesta es -> epicraneo <- [02:06] LibelulaBreve
Tiempo! La respuesta es -> epicraneo <-
[02:06] LibelulaBreve This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 69726 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065 [02:06] LibelulaBreve
This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 69726 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065
[02:06] LibelulaBreve Tri.4993 Miscelaneaɴarra˄erecho:sNegocioujur�couenkelyquemlosqc󮹵gesqrigenkdiversosqcontenidosqdemsucmatrimoniou?s [02:06] LibelulaBreve
Tri.4993 Miscelaneaɴarra˄erecho:sNegocioujur�couenkelyquemlosqc󮹵gesqrigenkdiversosqcontenidosqdemsucmatrimoniou?s
[02:06] LibelulaBreve 1 Pista: ********* ************* Valor pregunta : 24191 Puntos [02:06] LibelulaBreve
1 Pista: ********* ************* Valor pregunta : 24191 Puntos
[02:07] LibelulaBreve 2 Pista: cap****** ************* 30 segundos y 24191 Puntos [02:07] LibelulaBreve
2 Pista: cap****** ************* 30 segundos y 24191 Puntos
[02:07] LibelulaBreve 3 Pista: capi*u*o* *a**i*o*ia*e* 15 segundos y 24191 Puntos [02:07] LibelulaBreve
3 Pista: capi*u*o* *a**i*o*ia*e* 15 segundos y 24191 Puntos
[02:07] LibelulaBreve Tiempo! La respuesta es -> capitulos�atrimoniales <- [02:07] LibelulaBreve
Tiempo! La respuesta es -> capitulos�atrimoniales <-
[02:07] LibelulaBreve R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 [02:07] LibelulaBreve
R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244
[02:07] LibelulaBreve Tri.19861 Miscelaneaɬusieˆlores:j߃󭯃01zsehllamanalasqfloresqquehtienenalaccorolacenaformacdehtubo?j?j [02:07] LibelulaBreve
Tri.19861 Miscelaneaɬusieˆlores:j߃󭯃01zsehllamanalasqfloresqquehtienenalaccorolacenaformacdehtubo?j?j
[02:07] LibelulaBreve 1 Pista: ********* Pregunta de BONUS : 200000 Puntos [02:07] LibelulaBreve
1 Pista: ********* Pregunta de BONUS : 200000 Puntos
[02:08] LibelulaBreve 2 Pista: tub****** 30 segundos y 200000 Puntos [02:08] LibelulaBreve
2 Pista: tub****** 30 segundos y 200000 Puntos
[02:08] LibelulaBreve 3 Pista: tubu*o*a* 15 segundos y 200000 Puntos [02:08] LibelulaBreve
3 Pista: tubu*o*a* 15 segundos y 200000 Puntos
[02:08] LibelulaBreve Tiempo! La respuesta es -> tubulosas <- [02:08] LibelulaBreve
Tiempo! La respuesta es -> tubulosas <-
[02:08] LibelulaBreve Top10 Players ( Weekly & Monthly ) are Auto-Voiced [02:08] LibelulaBreve
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[02:08] LibelulaBreve Tri.20244 Miscelaneaɓebosin˿Aparecemenamuchosvpatron�cosvholandeses?f?f [02:08] LibelulaBreve
Tri.20244 Miscelaneaɓebosin˿Aparecemenamuchosvpatron�cosvholandeses?f?f
[02:08] LibelulaBreve 1 Pista: *** Valor pregunta : 17848 Puntos [02:08] LibelulaBreve
1 Pista: *** Valor pregunta : 17848 Puntos
[02:08] LibelulaBreve 2 Pista: van 30 segundos y 17848 Puntos [02:08] LibelulaBreve
2 Pista: van 30 segundos y 17848 Puntos
[02:09] LibelulaBreve 3 Pista: van 15 segundos y 17848 Puntos [02:09] LibelulaBreve
3 Pista: van 15 segundos y 17848 Puntos
[02:09] Gata_Suave van [02:09] Gata_Suave
van
[02:09] LibelulaBreve �Gata_Suave acert󡡠La respuesta era: "van" y contest󠥮 �0.141 segundos. Se lleva: �7848�12 puntos [02:09] LibelulaBreve
�Gata_Suave acert󡡠La respuesta era: "van" y contest󠥮 �0.141 segundos. Se lleva: �7848�12 puntos
[02:09] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:09] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:09] LibelulaBreve Gata_Suave has acertado 15 seguidas!! Puntos HOY: 497904, SEMANA: 497904 y MES: 497904 [02:09] LibelulaBreve
Gata_Suave has acertado 15 seguidas!! Puntos HOY: 497904, SEMANA: 497904 y MES: 497904
[02:09] LibelulaBreve Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [02:09] LibelulaBreve
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[02:09] LibelulaBreve Tri.6106 MiscelaneaɔeLaRaNhA˿Elwquewfiaeyqnowsabewcobrar...prontownowtendrae?s [02:09] LibelulaBreve
Tri.6106 MiscelaneaɔeLaRaNhA˿Elwquewfiaeyqnowsabewcobrar...prontownowtendrae?s
[02:09] LibelulaBreve 1 Pista: *** *** ***** Valor pregunta : 12013 Puntos [02:09] LibelulaBreve
1 Pista: *** *** ***** Valor pregunta : 12013 Puntos
[02:09] LibelulaBreve 2 Pista: con *** ***** 30 segundos y 12013 Puntos [02:09] LibelulaBreve
2 Pista: con *** ***** 30 segundos y 12013 Puntos
[02:09] Gata_Suave con que pagar [02:09] Gata_Suave
con que pagar
[02:09] LibelulaBreve �Absolutamente correcto Gata_Suave!! Acertaste "con que pagar" en �0.469 segundos y ganas �2013�12 puntos [02:09] LibelulaBreve
�Absolutamente correcto Gata_Suave!! Acertaste "con que pagar" en �0.469 segundos y ganas �2013�12 puntos
[02:09] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:09] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:09] LibelulaBreve Gata_Suave has acertado 16 seguidas!! Puntos HOY: 509917, SEMANA: 509917 y MES: 509917 [02:09] LibelulaBreve
Gata_Suave has acertado 16 seguidas!! Puntos HOY: 509917, SEMANA: 509917 y MES: 509917
[02:09] LibelulaBreve Tri.14802 CienciaɍarcaAcme˿Cualffuewelfplanetaymasilejanowalfsolfenj1999?j?j [02:09] LibelulaBreve
Tri.14802 CienciaɍarcaAcme˿Cualffuewelfplanetaymasilejanowalfsolfenj1999?j?j
[02:09] LibelulaBreve 1 Pista: ******* Pregunta de BONUS : 25000 Puntos [02:09] LibelulaBreve
1 Pista: ******* Pregunta de BONUS : 25000 Puntos
[02:10] LibelulaBreve 2 Pista: nep**** 30 segundos y 25000 Puntos [02:10] LibelulaBreve
2 Pista: nep**** 30 segundos y 25000 Puntos
[02:10] Gata_Suave pluton [02:10] Gata_Suave
pluton
[02:10] LibelulaBreve �Bingo!! Gata_Suave dio la respuesta: "neptuno" en �0.532 segundos e incrementa sus ganancias con �5000�12 puntos [02:10] LibelulaBreve
�Bingo!! Gata_Suave dio la respuesta: "neptuno" en �0.532 segundos e incrementa sus ganancias con �5000�12 puntos
[02:10] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:10] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:10] Gata_Suave neptuno [02:10] Gata_Suave
neptuno
[02:10] LibelulaBreve Gata_Suave has acertado 17 seguidas!! Puntos HOY: 534917, SEMANA: 534917 y MES: 534917 [02:10] LibelulaBreve
Gata_Suave has acertado 17 seguidas!! Puntos HOY: 534917, SEMANA: 534917 y MES: 534917
[02:10] LibelulaBreve We feature over 50,000 Q&A ! [02:10] LibelulaBreve
We feature over 50,000 Q&A !
[02:10] LibelulaBreve Tri.17819 Cineɣarlovigo˿Actoryhindu,ginterpretezentrezotraszdez"ElrladronddezBagdad"goq"Elrlibroqdezlagselva"g?g [02:10] LibelulaBreve
Tri.17819 Cineɣarlovigo˿Actoryhindu,ginterpretezentrezotraszdez"ElrladronddezBagdad"goq"Elrlibroqdezlagselva"g?g
[02:10] LibelulaBreve 1 Pista: **** Valor pregunta : 6591 Puntos [02:10] LibelulaBreve
1 Pista: **** Valor pregunta : 6591 Puntos
[02:10] LibelulaBreve 2 Pista: sab* 30 segundos y 6591 Puntos [02:10] LibelulaBreve
2 Pista: sab* 30 segundos y 6591 Puntos
[02:10] Gata_Suave saba [02:10] Gata_Suave
saba
[02:10] Gata_Suave sabu [02:10] Gata_Suave
sabu
[02:10] LibelulaBreve �Increible!! Gata_Suave contest󺠃04"sabu" en �6.766 segundos, y ha ganado �591�12 puntos [02:10] LibelulaBreve
�Increible!! Gata_Suave contest󺠃04"sabu" en �6.766 segundos, y ha ganado �591�12 puntos
[02:10] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:10] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:10] LibelulaBreve Gata_Suave has acertado 18 seguidas!! Puntos HOY: 541508, SEMANA: 541508 y MES: 541508 [02:10] LibelulaBreve
Gata_Suave has acertado 18 seguidas!! Puntos HOY: 541508, SEMANA: 541508 y MES: 541508
[02:10] Caiman{Sensible [Murcielago}Letal] hola [02:10] Caiman{Sensible
[Murcielago}Letal] hola
[02:11] LibelulaBreve Tri.8901 Miscelaneaɴjmm.com˔ipovdevpublicaci󮃰1dmarginalbsurgidayayfinalesvdevlosv70's.yDevtiradayreducida,ysuelendtrataradevm�sicayovcomicsvyvlayedici󮃰1dsevhacevcondfotocopias.y?y [02:11] LibelulaBreve
Tri.8901 Miscelaneaɴjmm.com˔ipovdevpublicaci󮃰1dmarginalbsurgidayayfinalesvdevlosv70's.yDevtiradayreducida,ysuelendtrataradevm�sicayovcomicsvyvlayedici󮃰1dsevhacevcondfotocopias.y?y
[02:11] LibelulaBreve 1 Pista: ******* Valor pregunta : 18166 Puntos [02:11] LibelulaBreve
1 Pista: ******* Valor pregunta : 18166 Puntos
[02:11] Murcielago}Letal Caiman{Sensible: hola ;) [02:11] Murcielago}Letal
Caiman{Sensible: hola ;)
[02:11] LibelulaBreve 2 Pista: fan**** 30 segundos y 18166 Puntos [02:11] LibelulaBreve
2 Pista: fan**** 30 segundos y 18166 Puntos
[02:11] LibelulaBreve 3 Pista: fan*i*e 15 segundos y 18166 Puntos [02:11] LibelulaBreve
3 Pista: fan*i*e 15 segundos y 18166 Puntos
[02:11] Gata_Suave fantasy [02:11] Gata_Suave
fantasy
[02:11] Gata_Suave fancine [02:11] Gata_Suave
fancine
[02:11] Gata_Suave fansine [02:11] Gata_Suave
fansine
[02:11] LibelulaBreve Tiempo! La respuesta es -> fanzine <- [02:11] LibelulaBreve
Tiempo! La respuesta es -> fanzine <-
[02:12] LibelulaBreve Tri.2120 EconomiaɍARdeJAVA˿CONrQUɃ01rNOMBRErERArCONOCOCIDArANTERIORMENTEr(DURANTErELrRɇIMENrCOMUNISTArSOVIɔICO)rLArCOMPAэArAɒEAr"RUSSIANrINTERNATIONALrAIRLINES"?r?r [02:12] LibelulaBreve
Tri.2120 EconomiaɍARdeJAVA˿CONrQUɃ01rNOMBRErERArCONOCOCIDArANTERIORMENTEr(DURANTErELrRɇIMENrCOMUNISTArSOVIɔICO)rLArCOMPAэArAɒEAr"RUSSIANrINTERNATIONALrAIRLINES"?r?r
[02:12] LibelulaBreve 1 Pista: ******** Valor pregunta : 12504 Puntos [02:12] LibelulaBreve
1 Pista: ******** Valor pregunta : 12504 Puntos
[02:12] Ardilla_Transparente 📻 Finalizando emisión. Vuelve el AutoDJ. [02:12] Ardilla_Transparente
📻 Finalizando emisión. Vuelve el AutoDJ.
[02:12] LibelulaBreve 2 Pista: aer***** 30 segundos y 12504 Puntos [02:12] LibelulaBreve
2 Pista: aer***** 30 segundos y 12504 Puntos
[02:12] LibelulaBreve 3 Pista: aero**o* 15 segundos y 12504 Puntos [02:12] LibelulaBreve
3 Pista: aero**o* 15 segundos y 12504 Puntos
[02:12] LibelulaBreve Tiempo! La respuesta es -> aeroflot <- [02:12] LibelulaBreve
Tiempo! La respuesta es -> aeroflot <-
[02:12] LibelulaBreve Please remember this is a FREE service, Please do not complain [02:12] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[02:12] LibelulaBreve Tri.20130 Idiomasɦlipp_er˿Comocsebdiceb"uno"qendlatin?q?q [02:12] LibelulaBreve
Tri.20130 Idiomasɦlipp_er˿Comocsebdiceb"uno"qendlatin?q?q
[02:12] LibelulaBreve 1 Pista: **** Valor pregunta : 5627 Puntos [02:12] LibelulaBreve
1 Pista: **** Valor pregunta : 5627 Puntos
[02:13] LibelulaBreve 2 Pista: unu* 30 segundos y 5627 Puntos [02:13] LibelulaBreve
2 Pista: unu* 30 segundos y 5627 Puntos
[02:13] Gata_Suave unus [02:13] Gata_Suave
unus
[02:13] LibelulaBreve �emuestra lo que sabes Gata_Suave! Has respondido "unus" correctamente y eso te da: �627�12 puntos [02:13] LibelulaBreve
�emuestra lo que sabes Gata_Suave! Has respondido "unus" correctamente y eso te da: �627�12 puntos
[02:13] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:13] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:13] LibelulaBreve Gata_Suave has acertado 19 seguidas!! Puntos HOY: 547135, SEMANA: 547135 y MES: 547135 [02:13] LibelulaBreve
Gata_Suave has acertado 19 seguidas!! Puntos HOY: 547135, SEMANA: 547135 y MES: 547135
[02:13] LibelulaBreve R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663 [02:13] LibelulaBreve
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663
[02:13] LibelulaBreve Tri.5725 Biologiaɴamzarian˿C󭯃01ssecllamaqalwanimalwdom鳴icosquechuyecalwcamposyisechacecmontaraz?b?b [02:13] LibelulaBreve
Tri.5725 Biologiaɴamzarian˿C󭯃01ssecllamaqalwanimalwdom鳴icosquechuyecalwcamposyisechacecmontaraz?b?b
[02:13] LibelulaBreve 1 Pista: ******** Valor pregunta : 9737 Puntos [02:13] LibelulaBreve
1 Pista: ******** Valor pregunta : 9737 Puntos
[02:13] LibelulaBreve 2 Pista: cim***** 30 segundos y 9737 Puntos [02:13] LibelulaBreve
2 Pista: cim***** 30 segundos y 9737 Puntos
[02:13] LibelulaBreve 3 Pista: cima**o* 15 segundos y 9737 Puntos [02:13] LibelulaBreve
3 Pista: cima**o* 15 segundos y 9737 Puntos
[02:14] Gata_Suave cimarron [02:14] Gata_Suave
cimarron
[02:14] LibelulaBreve �Eso es Gata_Suave!! Dijiste: "cimarron" y ello te ha valido: �737�12 puntos [02:14] LibelulaBreve
�Eso es Gata_Suave!! Dijiste: "cimarron" y ello te ha valido: �737�12 puntos
[02:14] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:14] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:14] LibelulaBreve Gata_Suave has acertado 20 seguidas!! Puntos HOY: 556872, SEMANA: 556872 y MES: 556872 [02:14] LibelulaBreve
Gata_Suave has acertado 20 seguidas!! Puntos HOY: 556872, SEMANA: 556872 y MES: 556872
[02:14] LibelulaBreve Bonus especial de 60000 Puntos para Gata_Suave por acertar 20 seguidas!!! [02:14] LibelulaBreve
Bonus especial de 60000 Puntos para Gata_Suave por acertar 20 seguidas!!!
[02:14] LibelulaBreve If you think a Q&A is wrong, please call an OP [02:14] LibelulaBreve
If you think a Q&A is wrong, please call an OP
[02:14] LibelulaBreve Tri.9017 Geografiaɓebosin˿Cuᬃ01ieraheliantiguodnombrerderlahislahderBioko?y(EnuestahislahserencuentrahMalabo,ylahCapitaliderGuineahEcuatorial)y?y [02:14] LibelulaBreve
Tri.9017 Geografiaɓebosin˿Cuᬃ01ieraheliantiguodnombrerderlahislahderBioko?y(EnuestahislahserencuentrahMalabo,ylahCapitaliderGuineahEcuatorial)y?y
[02:14] LibelulaBreve 1 Pista: ******** *** Valor pregunta : 6380 Puntos [02:14] LibelulaBreve
1 Pista: ******** *** Valor pregunta : 6380 Puntos
[02:14] LibelulaBreve 2 Pista: fer***** *** 30 segundos y 6380 Puntos [02:14] LibelulaBreve
2 Pista: fer***** *** 30 segundos y 6380 Puntos
[02:14] LibelulaBreve 3 Pista: fer*a**o *oo 15 segundos y 6380 Puntos [02:14] LibelulaBreve
3 Pista: fer*a**o *oo 15 segundos y 6380 Puntos
[02:14] Ardilla_Transparente 🎙️ ¡Iniciando emisión! DJ: karkamal | 🎶 Musica variada [02:14] Ardilla_Transparente
🎙️ ¡Iniciando emisión! DJ: karkamal | 🎶 Musica variada
[02:14] LibelulaBreve Tiempo! La respuesta es -> fernando�oo <- [02:14] LibelulaBreve
Tiempo! La respuesta es -> fernando�oo <-
[02:15] LibelulaBreve R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708 [02:15] LibelulaBreve
R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708
[02:15] LibelulaBreve Tri.17535 Cineɬusie˿DirectorodeiElutemibleiburl󮃰1n(1952)c?c [02:15] LibelulaBreve
Tri.17535 Cineɬusie˿DirectorodeiElutemibleiburl󮃰1n(1952)c?c
[02:15] LibelulaBreve 1 Pista: ****** ******* Pregunta de BONUS : 100000 Puntos [02:15] LibelulaBreve
1 Pista: ****** ******* Pregunta de BONUS : 100000 Puntos
[02:15] LibelulaBreve 2 Pista: rob*** ******* 30 segundos y 100000 Puntos [02:15] LibelulaBreve
2 Pista: rob*** ******* 30 segundos y 100000 Puntos
[02:15] LibelulaBreve 3 Pista: robe** *io**a* 15 segundos y 100000 Puntos [02:15] LibelulaBreve
3 Pista: robe** *io**a* 15 segundos y 100000 Puntos
[02:15] LibelulaBreve Tiempo! La respuesta es -> robert�iodmak <- [02:15] LibelulaBreve
Tiempo! La respuesta es -> robert�iodmak <-
[02:16] LibelulaBreve For The Competitive Edge type !pingme [02:16] LibelulaBreve
For The Competitive Edge type !pingme
[02:16] LibelulaBreve Tri.4612 Miscelaneaɓebosin˿Enrqu郰1hpa�01wnegaroconrlaicabezaisignificai"si"hyjasentiroquiereqdeciro"no"?h?h [02:16] LibelulaBreve
Tri.4612 Miscelaneaɓebosin˿Enrqu郰1hpa�01wnegaroconrlaicabezaisignificai"si"hyjasentiroquiereqdeciro"no"?h?h
[02:16] LibelulaBreve 1 Pista: ******** Valor pregunta : 16159 Puntos [02:16] LibelulaBreve
1 Pista: ******** Valor pregunta : 16159 Puntos
[02:16] Ardilla_Transparente 📻 Finalizando emisión. Vuelve el AutoDJ. [02:16] Ardilla_Transparente
📻 Finalizando emisión. Vuelve el AutoDJ.
[02:16] LibelulaBreve 2 Pista: bul***** 30 segundos y 16159 Puntos [02:16] LibelulaBreve
2 Pista: bul***** 30 segundos y 16159 Puntos
[02:16] Ardilla_Transparente 🎙️ ¡Iniciando emisión! DJ: karkamal | 🎶 Teddy _Swims [02:16] Ardilla_Transparente
🎙️ ¡Iniciando emisión! DJ: karkamal | 🎶 Teddy _Swims
[02:16] LibelulaBreve 3 Pista: bul*a*ia 15 segundos y 16159 Puntos [02:16] LibelulaBreve
3 Pista: bul*a*ia 15 segundos y 16159 Puntos
[02:16] Gata_Suave bulgaria [02:16] Gata_Suave
bulgaria
[02:16] LibelulaBreve �Increible!! Gata_Suave contest󺠃04"bulgaria" en �8.531 segundos, y ha ganado �6159�12 puntos [02:16] LibelulaBreve
�Increible!! Gata_Suave contest󺠃04"bulgaria" en �8.531 segundos, y ha ganado �6159�12 puntos
[02:16] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:16] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:16] LibelulaBreve Gata_Suave has acertado 21 seguidas!! Puntos HOY: 633031, SEMANA: 633031 y MES: 633031 [02:16] LibelulaBreve
Gata_Suave has acertado 21 seguidas!! Puntos HOY: 633031, SEMANA: 633031 y MES: 633031
[02:16] LibelulaBreve Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [02:16] LibelulaBreve
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[02:16] LibelulaBreve Tri.11974 IdiomasɁlkaid˿FRANCES-INGLES:CLAVIER?u?u [02:16] LibelulaBreve
Tri.11974 IdiomasɁlkaid˿FRANCES-INGLES:CLAVIER?u?u
[02:16] LibelulaBreve 1 Pista: ******** Valor pregunta : 17030 Puntos [02:16] LibelulaBreve
1 Pista: ******** Valor pregunta : 17030 Puntos
[02:17] LibelulaBreve 2 Pista: key***** 30 segundos y 17030 Puntos [02:17] LibelulaBreve
2 Pista: key***** 30 segundos y 17030 Puntos
[02:17] Murcielago}Letal keyboard [02:17] Murcielago}Letal
keyboard
[02:17] LibelulaBreve �emuestra lo que sabes Murcielago}Letal! Has respondido "keyboard" correctamente y eso te da: �7030�12 puntos [02:17] LibelulaBreve
�emuestra lo que sabes Murcielago}Letal! Has respondido "keyboard" correctamente y eso te da: �7030�12 puntos
[02:17] LibelulaBreve ACTION awards Murcielago}Letal with a +v for having over 15000 points [02:17] LibelulaBreve
ACTION awards Murcielago}Letal with a +v for having over 15000 points
[02:17] LibelulaBreve Murcielago}Letal has acertado 1 seguidas!! Puntos HOY: 17030, SEMANA: 17030 y MES: 86756 [02:17] LibelulaBreve
Murcielago}Letal has acertado 1 seguidas!! Puntos HOY: 17030, SEMANA: 17030 y MES: 86756
[02:17] LibelulaBreve R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: NN_vOx_Bukelizacion-YA 839312 #9: Gata_Suave 633031 #10: NN_vOx_Infierno-Fiscal 407404 [02:17] LibelulaBreve
R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: NN_vOx_Bukelizacion-YA 839312 #9: Gata_Suave 633031 #10: NN_vOx_Infierno-Fiscal 407404
[02:17] LibelulaBreve Tri.7744 Economiaɦlipp_er˿Dedquedpaisgesglaymonedayllamaday"librayegipcia"?a?a [02:17] LibelulaBreve
Tri.7744 Economiaɦlipp_er˿Dedquedpaisgesglaymonedayllamaday"librayegipcia"?a?a
[02:17] LibelulaBreve 1 Pista: ****** Valor pregunta : 16956 Puntos [02:17] LibelulaBreve
1 Pista: ****** Valor pregunta : 16956 Puntos
[02:17] Lince\Feroz saludos a toda la sala [02:17] Lince\Feroz
saludos a toda la sala
[02:17] Gata_Suave egipto [02:17] Gata_Suave
egipto
[02:17] LibelulaBreve �e nota que sabes mucho de esto Gata_Suave! Tu respuesta "egipto" es correcta y ganas �6956�12 puntos [02:17] LibelulaBreve
�e nota que sabes mucho de esto Gata_Suave! Tu respuesta "egipto" es correcta y ganas �6956�12 puntos
[02:17] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:17] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:17] LibelulaBreve Gata_Suave has acertado 1 seguidas!! Puntos HOY: 649987, SEMANA: 649987 y MES: 649987 [02:17] LibelulaBreve
Gata_Suave has acertado 1 seguidas!! Puntos HOY: 649987, SEMANA: 649987 y MES: 649987
[02:17] Gata_Suave saludos Lince\Feroz [02:17] Gata_Suave
saludos Lince\Feroz
[02:17] LibelulaBreve Please refrain from using Extreme Bad Language [02:17] LibelulaBreve
Please refrain from using Extreme Bad Language
[02:17] LibelulaBreve Tri.9420 Medicina-Saludɤuende1˿Cualcesolah1ʃ01pmanipulacionbquewhacewunbmasajistahenbunbmasajewdorsal?p?p [02:17] LibelulaBreve
Tri.9420 Medicina-Saludɤuende1˿Cualcesolah1ʃ01pmanipulacionbquewhacewunbmasajistahenbunbmasajewdorsal?p?p
[02:17] LibelulaBreve 1 Pista: ********** Valor pregunta : 18213 Puntos [02:17] LibelulaBreve
1 Pista: ********** Valor pregunta : 18213 Puntos
[02:18] LibelulaBreve 2 Pista: fri******* 30 segundos y 18213 Puntos [02:18] LibelulaBreve
2 Pista: fri******* 30 segundos y 18213 Puntos
[02:18] Murcielago}Letal Lince\Feroz: o/ [02:18] Murcielago}Letal
Lince\Feroz: o/
[02:18] Lince\Feroz hay una chica o mujer soltera para tener una conversación agradable y conocer? [02:18] Lince\Feroz
hay una chica o mujer soltera para tener una conversación agradable y conocer?
[02:18] LibelulaBreve 3 Pista: fri**io*e* 15 segundos y 18213 Puntos [02:18] LibelulaBreve
3 Pista: fri**io*e* 15 segundos y 18213 Puntos
[02:18] Gata_Suave fricciones [02:18] Gata_Suave
fricciones
[02:18] LibelulaBreve �Increible!! Gata_Suave contest󺠃04"fricciones" en �4.906 segundos, y ha ganado �8213�12 puntos [02:18] LibelulaBreve
�Increible!! Gata_Suave contest󺠃04"fricciones" en �4.906 segundos, y ha ganado �8213�12 puntos
[02:18] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:18] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:18] LibelulaBreve Gata_Suave has acertado 2 seguidas!! Puntos HOY: 668200, SEMANA: 668200 y MES: 668200 [02:18] LibelulaBreve
Gata_Suave has acertado 2 seguidas!! Puntos HOY: 668200, SEMANA: 668200 y MES: 668200
[02:18] LibelulaBreve This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve [02:18] LibelulaBreve
This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve
[02:18] LibelulaBreve Tri.19618 InformaticaɻDrAzHaR}˿Comohsedllama;denacualquiervcanalcdedircg;delctextohquedacompa񡃰1talcnombreddelccanalc?d [02:18] LibelulaBreve
Tri.19618 InformaticaɻDrAzHaR}˿Comohsedllama;denacualquiervcanalcdedircg;delctextohquedacompa񡃰1talcnombreddelccanalc?d
[02:18] LibelulaBreve 1 Pista: ***** Valor pregunta : 21538 Puntos [02:18] LibelulaBreve
1 Pista: ***** Valor pregunta : 21538 Puntos
[02:18] Lince\Feroz ketzy igual [02:18] Lince\Feroz
ketzy igual
[02:18] LibelulaBreve 2 Pista: top** 30 segundos y 21538 Puntos [02:18] LibelulaBreve
2 Pista: top** 30 segundos y 21538 Puntos
[02:19] Lince\Feroz que yal Gata_Suave [02:19] Lince\Feroz
que yal Gata_Suave
[02:19] LibelulaBreve 3 Pista: topi* 15 segundos y 21538 Puntos [02:19] LibelulaBreve
3 Pista: topi* 15 segundos y 21538 Puntos
[02:19] Gata_Suave topic [02:19] Gata_Suave
topic
[02:19] LibelulaBreve �Bingo!! Gata_Suave dio la respuesta: "topic" en �3.562 segundos e incrementa sus ganancias con �1538�12 puntos [02:19] LibelulaBreve
�Bingo!! Gata_Suave dio la respuesta: "topic" en �3.562 segundos e incrementa sus ganancias con �1538�12 puntos
[02:19] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:19] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:19] LibelulaBreve Gata_Suave has acertado 3 seguidas!! Puntos HOY: 689738, SEMANA: 689738 y MES: 689738 [02:19] LibelulaBreve
Gata_Suave has acertado 3 seguidas!! Puntos HOY: 689738, SEMANA: 689738 y MES: 689738
[02:19] Gata_Suave aqui jugando un rato Lince\Feroz [02:19] Gata_Suave
aqui jugando un rato Lince\Feroz
[02:19] Gata_Suave como le va a usted? [02:19] Gata_Suave
como le va a usted?
[02:19] LibelulaBreve This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [02:19] LibelulaBreve
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[02:19] LibelulaBreve Tri.20845 Biologiaɴjmm.com˂󶩤ogartiodᣴilogusadogenneljT�tacomoganimaljdevcarga,bporcsuglechevycsuglana.b?b [02:19] LibelulaBreve
Tri.20845 Biologiaɴjmm.com˂󶩤ogartiodᣴilogusadogenneljT�tacomoganimaljdevcarga,bporcsuglechevycsuglana.b?b
[02:19] LibelulaBreve 1 Pista: *** Valor pregunta : 9523 Puntos [02:19] LibelulaBreve
1 Pista: *** Valor pregunta : 9523 Puntos
[02:19] Ardilla_Transparente DJ "karkamal" abre peticiones [02:19] Ardilla_Transparente
DJ "karkamal" abre peticiones
[02:19] LibelulaBreve 2 Pista: yak 30 segundos y 9523 Puntos [02:19] LibelulaBreve
2 Pista: yak 30 segundos y 9523 Puntos
[02:19] LibelulaBreve �e nota que sabes mucho de esto Gata_Suave! Tu respuesta "yak" es correcta y ganas �523�12 puntos [02:19] LibelulaBreve
�e nota que sabes mucho de esto Gata_Suave! Tu respuesta "yak" es correcta y ganas �523�12 puntos
[02:19] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:19] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:19] LibelulaBreve Gata_Suave has acertado 4 seguidas!! Puntos HOY: 699261, SEMANA: 699261 y MES: 699261 [02:19] LibelulaBreve
Gata_Suave has acertado 4 seguidas!! Puntos HOY: 699261, SEMANA: 699261 y MES: 699261
[02:19] Gata_Suave yak [02:19] Gata_Suave
yak
[02:19] Lince\Feroz bien gracias. haber si conozco chica agradable [02:19] Lince\Feroz
bien gracias. haber si conozco chica agradable
[02:19] LibelulaBreve Please remember this is a FREE service, Please do not complain [02:19] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[02:19] LibelulaBreve Tri.14319 Mitologiaɲaziel9˿CONoQUEoTITANIDAoTUVOoZEUSoUNoROMANCEoQUEoTUVOoCOMOoHIJASoAoLASoMUSAS?o?o [02:19] LibelulaBreve
Tri.14319 Mitologiaɲaziel9˿CONoQUEoTITANIDAoTUVOoZEUSoUNoROMANCEoQUEoTUVOoCOMOoHIJASoAoLASoMUSAS?o?o
[02:19] LibelulaBreve 1 Pista: ********* Valor pregunta : 16494 Puntos [02:19] LibelulaBreve
1 Pista: ********* Valor pregunta : 16494 Puntos
[02:20] LibelulaBreve 2 Pista: mne****** 30 segundos y 16494 Puntos [02:20] LibelulaBreve
2 Pista: mne****** 30 segundos y 16494 Puntos
[02:20] Gata_Suave te deseo suerte en tu busqueda Lince\Feroz [02:20] Gata_Suave
te deseo suerte en tu busqueda Lince\Feroz
[02:20] Lince\Feroz gracias guapa [02:20] Lince\Feroz
gracias guapa
[02:20] LibelulaBreve 3 Pista: mne*o*i*e 15 segundos y 16494 Puntos [02:20] LibelulaBreve
3 Pista: mne*o*i*e 15 segundos y 16494 Puntos
[02:20] LibelulaBreve Tiempo! La respuesta es -> mnemosine <- [02:20] LibelulaBreve
Tiempo! La respuesta es -> mnemosine <-
[02:20] LibelulaBreve This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 86756 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065 [02:20] LibelulaBreve
This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 86756 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065
[02:20] LibelulaBreve Tri.11843 Musicaɓheva˿Consqu郰1zotrocnombrelselconocelaaJulio,zbajocdelzgrupocSka-pk?z [02:20] LibelulaBreve
Tri.11843 Musicaɓheva˿Consqu郰1zotrocnombrelselconocelaaJulio,zbajocdelzgrupocSka-pk?z
[02:20] LibelulaBreve 1 Pista: ******** Valor pregunta : 13801 Puntos [02:20] LibelulaBreve
1 Pista: ******** Valor pregunta : 13801 Puntos
[02:20] LibelulaBreve 2 Pista: jul***** 30 segundos y 13801 Puntos [02:20] LibelulaBreve
2 Pista: jul***** 30 segundos y 13801 Puntos
[02:21] LibelulaBreve 3 Pista: juli**o* 15 segundos y 13801 Puntos [02:21] LibelulaBreve
3 Pista: juli**o* 15 segundos y 13801 Puntos
[02:21] LibelulaBreve Tiempo! La respuesta es -> julitros <- [02:21] LibelulaBreve
Tiempo! La respuesta es -> julitros <-
[02:21] LibelulaBreve R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 [02:21] LibelulaBreve
R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244
[02:21] LibelulaBreve Tri.13034 Informaticaɍorigutsu˿COMANDOSwUNIX:wMUESTRAwELwESTADOwDEwLAwCOLAwDEwIMPRESIONw?w [02:21] LibelulaBreve
Tri.13034 Informaticaɍorigutsu˿COMANDOSwUNIX:wMUESTRAwELwESTADOwDEwLAwCOLAwDEwIMPRESIONw?w
[02:21] LibelulaBreve 1 Pista: ****** Valor pregunta : 13556 Puntos [02:21] LibelulaBreve
1 Pista: ****** Valor pregunta : 13556 Puntos
[02:21] LibelulaBreve 2 Pista: lps*** 30 segundos y 13556 Puntos [02:21] LibelulaBreve
2 Pista: lps*** 30 segundos y 13556 Puntos
[02:22] LibelulaBreve 3 Pista: lps*a* 15 segundos y 13556 Puntos [02:22] LibelulaBreve
3 Pista: lps*a* 15 segundos y 13556 Puntos
[02:22] LibelulaBreve Tiempo! La respuesta es -> lpstat <- [02:22] LibelulaBreve
Tiempo! La respuesta es -> lpstat <-
[02:22] LibelulaBreve Top10 Players ( Weekly & Monthly ) are Auto-Voiced [02:22] LibelulaBreve
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[02:22] LibelulaBreve Tri.8326 LiteraturaɁigua˿BREVEsOBRAsTEATRALsQUEsSEsSOLIAsINTERPRETARsENsELsINTERMEDIOsDEsUNAsLARGAs?s [02:22] LibelulaBreve
Tri.8326 LiteraturaɁigua˿BREVEsOBRAsTEATRALsQUEsSEsSOLIAsINTERPRETARsENsELsINTERMEDIOsDEsUNAsLARGAs?s
[02:22] LibelulaBreve 1 Pista: ******** Valor pregunta : 16757 Puntos [02:22] LibelulaBreve
1 Pista: ******** Valor pregunta : 16757 Puntos
[02:22] LibelulaBreve 2 Pista: ent***** 30 segundos y 16757 Puntos [02:22] LibelulaBreve
2 Pista: ent***** 30 segundos y 16757 Puntos
[02:23] LibelulaBreve 3 Pista: ent*e*e* 15 segundos y 16757 Puntos [02:23] LibelulaBreve
3 Pista: ent*e*e* 15 segundos y 16757 Puntos
[02:23] LibelulaBreve Tiempo! La respuesta es -> entremes <- [02:23] LibelulaBreve
Tiempo! La respuesta es -> entremes <-
[02:23] LibelulaBreve Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [02:23] LibelulaBreve
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[02:23] LibelulaBreve Tri.115 Biologiaɦlipp_er˿Cuantozdurakelvperiodozdedgestacionjdelvcerdoz?l [02:23] LibelulaBreve
Tri.115 Biologiaɦlipp_er˿Cuantozdurakelvperiodozdedgestacionjdelvcerdoz?l
[02:23] LibelulaBreve 1 Pista: *** **** Pregunta de BONUS : 50000 Puntos [02:23] LibelulaBreve
1 Pista: *** **** Pregunta de BONUS : 50000 Puntos
[02:23] Gata_Suave dos meses [02:23] Gata_Suave
dos meses
[02:23] LibelulaBreve 2 Pista: 114 **** 30 segundos y 50000 Puntos [02:23] LibelulaBreve
2 Pista: 114 **** 30 segundos y 50000 Puntos
[02:23] Gata_Suave 114 dias [02:23] Gata_Suave
114 dias
[02:23] LibelulaBreve �Ol頃04Gata_Suave!! Has contestado: "114 dias" en �0.922 segundos y sumas �0000�12 puntos a tu marcador. �Sigue as� [02:23] LibelulaBreve
�Ol頃04Gata_Suave!! Has contestado: "114 dias" en �0.922 segundos y sumas �0000�12 puntos a tu marcador. �Sigue as�
[02:23] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:23] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:23] LibelulaBreve Gata_Suave has acertado 5 seguidas!! Puntos HOY: 749261, SEMANA: 749261 y MES: 749261 [02:23] LibelulaBreve
Gata_Suave has acertado 5 seguidas!! Puntos HOY: 749261, SEMANA: 749261 y MES: 749261
[02:24] LibelulaBreve Tri.15753 MusicaɈdosO˿CualmesllahnacionalidadydelmcantanteuyncompositorrRubenfBladesl?l [02:24] LibelulaBreve
Tri.15753 MusicaɈdosO˿CualmesllahnacionalidadydelmcantanteuyncompositorrRubenfBladesl?l
[02:24] LibelulaBreve 1 Pista: ******񪠃 Pregunta de BONUS : 200000 Puntos [02:24] LibelulaBreve
1 Pista: ******񪠃 Pregunta de BONUS : 200000 Puntos
[02:24] LibelulaBreve 2 Pista: pan***񪠃 30 segundos y 200000 Puntos [02:24] LibelulaBreve
2 Pista: pan***񪠃 30 segundos y 200000 Puntos
[02:24] Gata_Suave panameño [02:24] Gata_Suave
panameño
[02:24] LibelulaBreve 3 Pista: pana*e񡠃 15 segundos y 200000 Puntos [02:24] LibelulaBreve
3 Pista: pana*e񡠃 15 segundos y 200000 Puntos
[02:24] LibelulaBreve Tiempo! La respuesta es -> paname񡠃12 <- [02:24] LibelulaBreve
Tiempo! La respuesta es -> paname񡠃12 <-
[02:24] LibelulaBreve We feature over 50,000 Q&A ! [02:24] LibelulaBreve
We feature over 50,000 Q&A !
[02:24] LibelulaBreve Tri.18057 Medicina-Saludɴamzarian˿Contravqu郰1xenfermedadrparasitariavsewempleavelmbenzoatoidewbencilo?x?x [02:24] LibelulaBreve
Tri.18057 Medicina-Saludɴamzarian˿Contravqu郰1xenfermedadrparasitariavsewempleavelmbenzoatoidewbencilo?x?x
[02:24] LibelulaBreve 1 Pista: ***** Valor pregunta : 13165 Puntos [02:24] LibelulaBreve
1 Pista: ***** Valor pregunta : 13165 Puntos
[02:25] LibelulaBreve 2 Pista: sar** 30 segundos y 13165 Puntos [02:25] LibelulaBreve
2 Pista: sar** 30 segundos y 13165 Puntos
[02:25] LibelulaBreve �Bien Gata_Suave!! Tu respuesta: "sarna" es correcta y ganas �3165�12 puntos [02:25] LibelulaBreve
�Bien Gata_Suave!! Tu respuesta: "sarna" es correcta y ganas �3165�12 puntos
[02:25] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:25] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:25] LibelulaBreve Gata_Suave has acertado 6 seguidas!! Puntos HOY: 762426, SEMANA: 762426 y MES: 762426 [02:25] LibelulaBreve
Gata_Suave has acertado 6 seguidas!! Puntos HOY: 762426, SEMANA: 762426 y MES: 762426
[02:25] Gata_Suave sarna [02:25] Gata_Suave
sarna
[02:25] LibelulaBreve Tri.10361 MitologiaɔeLaRaNhA˿Egiptologia:spersonificaci󮃰1edelapoderjdelaSola?s [02:25] LibelulaBreve
Tri.10361 MitologiaɔeLaRaNhA˿Egiptologia:spersonificaci󮃰1edelapoderjdelaSola?s
[02:25] LibelulaBreve 1 Pista: **** Valor pregunta : 15900 Puntos [02:25] LibelulaBreve
1 Pista: **** Valor pregunta : 15900 Puntos
[02:25] LibelulaBreve 2 Pista: hek* 30 segundos y 15900 Puntos [02:25] LibelulaBreve
2 Pista: hek* 30 segundos y 15900 Puntos
[02:25] LibelulaBreve 3 Pista: heka 15 segundos y 15900 Puntos [02:25] LibelulaBreve
3 Pista: heka 15 segundos y 15900 Puntos
[02:26] Gata_Suave heka [02:26] Gata_Suave
heka
[02:26] LibelulaBreve �Increible!! Gata_Suave contest󺠃04"heka" en �7.015 segundos, y ha ganado �5900�12 puntos [02:26] LibelulaBreve
�Increible!! Gata_Suave contest󺠃04"heka" en �7.015 segundos, y ha ganado �5900�12 puntos
[02:26] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:26] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:26] LibelulaBreve Gata_Suave has acertado 7 seguidas!! Puntos HOY: 778326, SEMANA: 778326 y MES: 778326 [02:26] LibelulaBreve
Gata_Suave has acertado 7 seguidas!! Puntos HOY: 778326, SEMANA: 778326 y MES: 778326
[02:26] LibelulaBreve Tri.87 Biologiaɳtephenwo˿Cuantosfkilosfpesabafelrcolmillojdebelefantebm᳃01fpesado,aentnumerosfredondos?a?a [02:26] LibelulaBreve
Tri.87 Biologiaɳtephenwo˿Cuantosfkilosfpesabafelrcolmillojdebelefantebm᳃01fpesado,aentnumerosfredondos?a?a
[02:26] LibelulaBreve 1 Pista: *** Valor pregunta : 10851 Puntos [02:26] LibelulaBreve
1 Pista: *** Valor pregunta : 10851 Puntos
[02:26] LibelulaBreve 2 Pista: 100 30 segundos y 10851 Puntos [02:26] LibelulaBreve
2 Pista: 100 30 segundos y 10851 Puntos
[02:26] Gata_Suave 100 [02:26] Gata_Suave
100
[02:26] LibelulaBreve �Est᳠que lo tiras Gata_Suave!! ߃󭯠supiste que "100" era la respuesta? Venga, �0851�12 puntos suben a tu marcador [02:26] LibelulaBreve
�Est᳠que lo tiras Gata_Suave!! ߃󭯠supiste que "100" era la respuesta? Venga, �0851�12 puntos suben a tu marcador
[02:26] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:26] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:26] LibelulaBreve Gata_Suave has acertado 8 seguidas!! Puntos HOY: 789177, SEMANA: 789177 y MES: 789177 [02:26] LibelulaBreve
Gata_Suave has acertado 8 seguidas!! Puntos HOY: 789177, SEMANA: 789177 y MES: 789177
[02:26] LibelulaBreve Please remember this is a FREE service, Please do not complain [02:26] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[02:26] LibelulaBreve Tri.9923 IdiomasɍARdeJAVA˿CӍOpSEpDICEpENpGRIEGOp"TERRIBLES"?p?p [02:26] LibelulaBreve
Tri.9923 IdiomasɍARdeJAVA˿CӍOpSEpDICEpENpGRIEGOp"TERRIBLES"?p?p
[02:26] LibelulaBreve 1 Pista: ******* Valor pregunta : 17781 Puntos [02:26] LibelulaBreve
1 Pista: ******* Valor pregunta : 17781 Puntos
[02:26] LibelulaBreve 2 Pista: gor**** 30 segundos y 17781 Puntos [02:26] LibelulaBreve
2 Pista: gor**** 30 segundos y 17781 Puntos
[02:27] LibelulaBreve 3 Pista: gori*a* 15 segundos y 17781 Puntos [02:27] LibelulaBreve
3 Pista: gori*a* 15 segundos y 17781 Puntos
[02:27] LibelulaBreve �Bien Gata_Suave!! Tu respuesta: "gorilas" es correcta y ganas �7781�12 puntos [02:27] LibelulaBreve
�Bien Gata_Suave!! Tu respuesta: "gorilas" es correcta y ganas �7781�12 puntos
[02:27] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:27] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:27] LibelulaBreve Gata_Suave has acertado 9 seguidas!! Puntos HOY: 806958, SEMANA: 806958 y MES: 806958 [02:27] LibelulaBreve
Gata_Suave has acertado 9 seguidas!! Puntos HOY: 806958, SEMANA: 806958 y MES: 806958
[02:27] Gata_Suave gorilas [02:27] Gata_Suave
gorilas
[02:27] LibelulaBreve R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663 [02:27] LibelulaBreve
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663
[02:27] LibelulaBreve Tri.20234 LiteraturaɔeLaRaNhA˿Autorvdes"losrcuernosrdesdonkfriolera"q?q [02:27] LibelulaBreve
Tri.20234 LiteraturaɔeLaRaNhA˿Autorvdes"losrcuernosrdesdonkfriolera"q?q
[02:27] LibelulaBreve 1 Pista: *****-****** Valor pregunta : 12388 Puntos [02:27] LibelulaBreve
1 Pista: *****-****** Valor pregunta : 12388 Puntos
[02:27] LibelulaBreve 2 Pista: val**-****** 30 segundos y 12388 Puntos [02:27] LibelulaBreve
2 Pista: val**-****** 30 segundos y 12388 Puntos
[02:28] LibelulaBreve 3 Pista: val*e-i***a* 15 segundos y 12388 Puntos [02:28] LibelulaBreve
3 Pista: val*e-i***a* 15 segundos y 12388 Puntos
[02:28] LibelulaBreve Tiempo! La respuesta es -> valle-inclan <- [02:28] LibelulaBreve
Tiempo! La respuesta es -> valle-inclan <-
[02:28] LibelulaBreve If you think a Q&A is wrong, please call an OP [02:28] LibelulaBreve
If you think a Q&A is wrong, please call an OP
[02:28] LibelulaBreve Tri.17251 Fisica-QuimicaɃocoman˿Cuᬃ01ueshladreaccionmquimicadcontrariadyzanalogadadladoxidacion?g?g [02:28] LibelulaBreve
Tri.17251 Fisica-QuimicaɃocoman˿Cuᬃ01ueshladreaccionmquimicadcontrariadyzanalogadadladoxidacion?g?g
[02:28] LibelulaBreve 1 Pista: ********* Valor pregunta : 16642 Puntos [02:28] LibelulaBreve
1 Pista: ********* Valor pregunta : 16642 Puntos
[02:28] LibelulaBreve 2 Pista: red****** 30 segundos y 16642 Puntos [02:28] LibelulaBreve
2 Pista: red****** 30 segundos y 16642 Puntos
[02:28] LibelulaBreve 3 Pista: redu**io* 15 segundos y 16642 Puntos [02:28] LibelulaBreve
3 Pista: redu**io* 15 segundos y 16642 Puntos
[02:29] LibelulaBreve Tiempo! La respuesta es -> reduccion <- [02:29] LibelulaBreve
Tiempo! La respuesta es -> reduccion <-
[02:29] LibelulaBreve R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708 [02:29] LibelulaBreve
R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708
[02:29] LibelulaBreve Tri.2286 Medicina-Saludɖivian˿Ayqu郰1ysientenjodiorlosuqueipadecenjtriscaidecafobia?y?y [02:29] LibelulaBreve
Tri.2286 Medicina-Saludɖivian˿Ayqu郰1ysientenjodiorlosuqueipadecenjtriscaidecafobia?y?y
[02:29] LibelulaBreve 1 Pista: ** ****** ***** Valor pregunta : 13004 Puntos [02:29] LibelulaBreve
1 Pista: ** ****** ***** Valor pregunta : 13004 Puntos
[02:29] LibelulaBreve 2 Pista: al�***** ***** 30 segundos y 13004 Puntos [02:29] LibelulaBreve
2 Pista: al�***** ***** 30 segundos y 13004 Puntos
[02:29] LibelulaBreve 3 Pista: al�u*e*o **e*e 15 segundos y 13004 Puntos [02:29] LibelulaBreve
3 Pista: al�u*e*o **e*e 15 segundos y 13004 Puntos
[02:30] LibelulaBreve Tiempo! La respuesta es -> al�umero�rece <- [02:30] LibelulaBreve
Tiempo! La respuesta es -> al�umero�rece <-
[02:30] LibelulaBreve For The Competitive Edge type !pingme [02:30] LibelulaBreve
For The Competitive Edge type !pingme
[02:30] LibelulaBreve Tri.19279 DeporteɔDI˿DONDEaNACIOaELaMEDIOaCENTROaLUISaMILLAa?a [02:30] LibelulaBreve
Tri.19279 DeporteɔDI˿DONDEaNACIOaELaMEDIOaCENTROaLUISaMILLAa?a
[02:30] LibelulaBreve 1 Pista: ****** Valor pregunta : 13646 Puntos [02:30] LibelulaBreve
1 Pista: ****** Valor pregunta : 13646 Puntos
[02:30] LibelulaBreve 2 Pista: ter*** 30 segundos y 13646 Puntos [02:30] LibelulaBreve
2 Pista: ter*** 30 segundos y 13646 Puntos
[02:30] LibelulaBreve 3 Pista: terue* 15 segundos y 13646 Puntos [02:30] LibelulaBreve
3 Pista: terue* 15 segundos y 13646 Puntos
[02:30] Gata_Suave teruel [02:30] Gata_Suave
teruel
[02:30] LibelulaBreve �Muy bien Gata_Suave!! Acertaste "teruel" en tan s󬯠�9.265 segundos y por eso has ganado: �3646�12 puntos [02:30] LibelulaBreve
�Muy bien Gata_Suave!! Acertaste "teruel" en tan s󬯠�9.265 segundos y por eso has ganado: �3646�12 puntos
[02:30] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:30] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:30] LibelulaBreve Gata_Suave has acertado 10 seguidas!! Puntos HOY: 820604, SEMANA: 820604 y MES: 820604 [02:30] LibelulaBreve
Gata_Suave has acertado 10 seguidas!! Puntos HOY: 820604, SEMANA: 820604 y MES: 820604
[02:30] LibelulaBreve Bonus especial de 50000 Puntos para Gata_Suave por acertar 10 seguidas!!! [02:30] LibelulaBreve
Bonus especial de 50000 Puntos para Gata_Suave por acertar 10 seguidas!!!
[02:31] LibelulaBreve Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [02:31] LibelulaBreve
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[02:31] LibelulaBreve Tri.8667 Miscelaneaɓebosin˿Conkqui鮃01kselcas󃰱vlaqestatuaqdelCol󮃰1kquelhayqenkBarcelona?v?v [02:31] LibelulaBreve
Tri.8667 Miscelaneaɓebosin˿Conkqui鮃01kselcas󃰱vlaqestatuaqdelCol󮃰1kquelhayqenkBarcelona?v?v
[02:31] LibelulaBreve 1 Pista: ******* ** ** ******** Valor pregunta : 24794 Puntos [02:31] LibelulaBreve
1 Pista: ******* ** ** ******** Valor pregunta : 24794 Puntos
[02:31] LibelulaBreve 2 Pista: est**** ** ** ******** 30 segundos y 24794 Puntos [02:31] LibelulaBreve
2 Pista: est**** ** ** ******** 30 segundos y 24794 Puntos
[02:31] LibelulaBreve 3 Pista: esta*ua *e *a *i*e**a* 15 segundos y 24794 Puntos [02:31] LibelulaBreve
3 Pista: esta*ua *e *a *i*e**a* 15 segundos y 24794 Puntos
[02:31] LibelulaBreve Tiempo! La respuesta es -> estatua�e�a�ibertad <- [02:31] LibelulaBreve
Tiempo! La respuesta es -> estatua�e�a�ibertad <-
[02:32] LibelulaBreve R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: Gata_Suave 870604 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404 [02:32] LibelulaBreve
R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: Gata_Suave 870604 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404
[02:32] LibelulaBreve Tri.2315 Historiaɳubmarin˿Cualpfuemelpprimerbcruceroydembatallauestadounidense?k?k [02:32] LibelulaBreve
Tri.2315 Historiaɳubmarin˿Cualpfuemelpprimerbcruceroydembatallauestadounidense?k?k
[02:32] LibelulaBreve 1 Pista: ****** Valor pregunta : 21146 Puntos [02:32] LibelulaBreve
1 Pista: ****** Valor pregunta : 21146 Puntos
[02:32] LibelulaBreve 2 Pista: ala*** 30 segundos y 21146 Puntos [02:32] LibelulaBreve
2 Pista: ala*** 30 segundos y 21146 Puntos
[02:32] Gata_Suave alaska [02:32] Gata_Suave
alaska
[02:32] LibelulaBreve �Increible!! Gata_Suave contest󺠃04"alaska" en �9.687 segundos, y ha ganado �1146�12 puntos [02:32] LibelulaBreve
�Increible!! Gata_Suave contest󺠃04"alaska" en �9.687 segundos, y ha ganado �1146�12 puntos
[02:32] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:32] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:32] LibelulaBreve Gata_Suave has acertado 11 seguidas!! Puntos HOY: 891750, SEMANA: 891750 y MES: 891750 [02:32] LibelulaBreve
Gata_Suave has acertado 11 seguidas!! Puntos HOY: 891750, SEMANA: 891750 y MES: 891750
[02:32] LibelulaBreve Please refrain from using Extreme Bad Language [02:32] LibelulaBreve
Please refrain from using Extreme Bad Language
[02:32] LibelulaBreve Tri.19274 Cienciaɤassler˿C󭯃01hseqllamarlaracumulaci󮃰1horiginadarporflaractividadkdequnhr�01hyclocalizadarenhunhvalle?s?s [02:32] LibelulaBreve
Tri.19274 Cienciaɤassler˿C󭯃01hseqllamarlaracumulaci󮃰1horiginadarporflaractividadkdequnhr�01hyclocalizadarenhunhvalle?s?s
[02:32] LibelulaBreve 1 Pista: ******* ******* Valor pregunta : 24222 Puntos [02:32] LibelulaBreve
1 Pista: ******* ******* Valor pregunta : 24222 Puntos
[02:32] LibelulaBreve 2 Pista: ter**** ******* 30 segundos y 24222 Puntos [02:32] LibelulaBreve
2 Pista: ter**** ******* 30 segundos y 24222 Puntos
[02:33] LibelulaBreve 3 Pista: ter*a*a **u*ia* 15 segundos y 24222 Puntos [02:33] LibelulaBreve
3 Pista: ter*a*a **u*ia* 15 segundos y 24222 Puntos
[02:33] LibelulaBreve Tiempo! La respuesta es -> terraza�luvial <- [02:33] LibelulaBreve
Tiempo! La respuesta es -> terraza�luvial <-
[02:33] LibelulaBreve This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve [02:33] LibelulaBreve
This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve
[02:33] LibelulaBreve Tri.10513 Medicina-Saludɯlguita˿Endqueborganofsebproduceblatbilis?w?w [02:33] LibelulaBreve
Tri.10513 Medicina-Saludɯlguita˿Endqueborganofsebproduceblatbilis?w?w
[02:33] LibelulaBreve 1 Pista: ****** Valor pregunta : 18644 Puntos [02:33] LibelulaBreve
1 Pista: ****** Valor pregunta : 18644 Puntos
[02:33] LibelulaBreve 2 Pista: hig*** 30 segundos y 18644 Puntos [02:33] LibelulaBreve
2 Pista: hig*** 30 segundos y 18644 Puntos
[02:33] Gata_Suave estomago [02:33] Gata_Suave
estomago
[02:33] Gata_Suave higado [02:33] Gata_Suave
higado
[02:33] LibelulaBreve �Bingo!! Gata_Suave dio la respuesta: "higado" en �3.187 segundos e incrementa sus ganancias con �8644�12 puntos [02:33] LibelulaBreve
�Bingo!! Gata_Suave dio la respuesta: "higado" en �3.187 segundos e incrementa sus ganancias con �8644�12 puntos
[02:33] LibelulaBreve ACTION Aplausos Gata_Suave una Pepsi y pizza por 900000 victorias!! Ole Gata_Suave!!! [02:33] LibelulaBreve
ACTION Aplausos Gata_Suave una Pepsi y pizza por 900000 victorias!! Ole Gata_Suave!!!
[02:33] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:33] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:33] LibelulaBreve Gata_Suave has acertado 12 seguidas!! Puntos HOY: 910394, SEMANA: 910394 y MES: 910394 [02:33] LibelulaBreve
Gata_Suave has acertado 12 seguidas!! Puntos HOY: 910394, SEMANA: 910394 y MES: 910394
[02:34] LibelulaBreve This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [02:34] LibelulaBreve
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[02:34] LibelulaBreve Tri.11486 PersonajesɓTAMPID˿CӍOqSEqLLAMAqELqPORTAVOZqESPA񏌃01qDEqLAqCIUDADqDELqVATICANO?q?q [02:34] LibelulaBreve
Tri.11486 PersonajesɓTAMPID˿CӍOqSEqLLAMAqELqPORTAVOZqESPA񏌃01qDEqLAqCIUDADqDELqVATICANO?q?q
[02:34] LibelulaBreve 1 Pista: ******* ******* Pregunta de BONUS : 200000 Puntos [02:34] LibelulaBreve
1 Pista: ******* ******* Pregunta de BONUS : 200000 Puntos
[02:34] LibelulaBreve 2 Pista: joa**** ******* 30 segundos y 200000 Puntos [02:34] LibelulaBreve
2 Pista: joa**** ******* 30 segundos y 200000 Puntos
[02:34] LibelulaBreve 3 Pista: joa*ui* *a*a**o 15 segundos y 200000 Puntos [02:34] LibelulaBreve
3 Pista: joa*ui* *a*a**o 15 segundos y 200000 Puntos
[02:34] LibelulaBreve Tiempo! La respuesta es -> joaquin�avarro <- [02:34] LibelulaBreve
Tiempo! La respuesta es -> joaquin�avarro <-
[02:34] LibelulaBreve Please remember this is a FREE service, Please do not complain [02:34] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[02:34] LibelulaBreve Tri.16091 Informaticaɣuchi-˿INTRUCCIONrDErAMSTRADrPARArCAMBIARrDErPLUMILLArALrESCRIBIRrUNrTEXTOr?r [02:34] LibelulaBreve
Tri.16091 Informaticaɣuchi-˿INTRUCCIONrDErAMSTRADrPARArCAMBIARrDErPLUMILLArALrESCRIBIRrUNrTEXTOr?r
[02:34] LibelulaBreve 1 Pista: *** Valor pregunta : 16095 Puntos [02:34] LibelulaBreve
1 Pista: *** Valor pregunta : 16095 Puntos
[02:35] LibelulaBreve 2 Pista: pen 30 segundos y 16095 Puntos [02:35] LibelulaBreve
2 Pista: pen 30 segundos y 16095 Puntos
[02:35] LibelulaBreve �Muy bien Gata_Suave!! Acertaste "pen" en tan s󬯠�8.969 segundos y por eso has ganado: �6095�12 puntos [02:35] LibelulaBreve
�Muy bien Gata_Suave!! Acertaste "pen" en tan s󬯠�8.969 segundos y por eso has ganado: �6095�12 puntos
[02:35] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:35] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:35] LibelulaBreve Gata_Suave has acertado 13 seguidas!! Puntos HOY: 926489, SEMANA: 926489 y MES: 926489 [02:35] LibelulaBreve
Gata_Suave has acertado 13 seguidas!! Puntos HOY: 926489, SEMANA: 926489 y MES: 926489
[02:35] Gata_Suave pen [02:35] Gata_Suave
pen
[02:35] LibelulaBreve This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 86756 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065 [02:35] LibelulaBreve
This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 86756 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065
[02:35] LibelulaBreve Tri.11100 Literaturaɭeji˿Autoridem"sue񯳃01mdemrobot"y?y [02:35] LibelulaBreve
Tri.11100 Literaturaɭeji˿Autoridem"sue񯳃01mdemrobot"y?y
[02:35] LibelulaBreve 1 Pista: ***** ****** Valor pregunta : 11789 Puntos [02:35] LibelulaBreve
1 Pista: ***** ****** Valor pregunta : 11789 Puntos
[02:35] LibelulaBreve 2 Pista: isa** ****** 30 segundos y 11789 Puntos [02:35] LibelulaBreve
2 Pista: isa** ****** 30 segundos y 11789 Puntos
[02:36] LibelulaBreve 3 Pista: isaa* a*i*o* 15 segundos y 11789 Puntos [02:36] LibelulaBreve
3 Pista: isaa* a*i*o* 15 segundos y 11789 Puntos
[02:36] LibelulaBreve Tiempo! La respuesta es -> isaac�simov <- [02:36] LibelulaBreve
Tiempo! La respuesta es -> isaac�simov <-
[02:36] LibelulaBreve R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 [02:36] LibelulaBreve
R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244
[02:36] LibelulaBreve Tri.5442 Geografiaɂatval˿AVIACION-NOMBREaDELaAEROPUERTOaDEaREIMSa?a [02:36] LibelulaBreve
Tri.5442 Geografiaɂatval˿AVIACION-NOMBREaDELaAEROPUERTOaDEaREIMSa?a
[02:36] LibelulaBreve 1 Pista: ********* Valor pregunta : 22177 Puntos [02:36] LibelulaBreve
1 Pista: ********* Valor pregunta : 22177 Puntos
[02:36] LibelulaBreve 2 Pista: cha****** 30 segundos y 22177 Puntos [02:36] LibelulaBreve
2 Pista: cha****** 30 segundos y 22177 Puntos
[02:36] LibelulaBreve 3 Pista: cha**a**e 15 segundos y 22177 Puntos [02:36] LibelulaBreve
3 Pista: cha**a**e 15 segundos y 22177 Puntos
[02:37] LibelulaBreve Tiempo! La respuesta es -> champagne <- [02:37] LibelulaBreve
Tiempo! La respuesta es -> champagne <-
[02:37] LibelulaBreve Top10 Players ( Weekly & Monthly ) are Auto-Voiced [02:37] LibelulaBreve
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[02:37] LibelulaBreve Tri.7931 CineɍARdeJAVA˿CU�cFUEcLAcڌTIMAcPEL̓ULAcDEcANIMACIӎcSUPERVISADAcPERSONALMENTEcPORcWALTcDISNEY,cENc1966,cPOCOScMESEScANTEScDEcQUEcMURIERAcDEcC�CERcPULMONAR?c?c [02:37] LibelulaBreve
Tri.7931 CineɍARdeJAVA˿CU�cFUEcLAcڌTIMAcPEL̓ULAcDEcANIMACIӎcSUPERVISADAcPERSONALMENTEcPORcWALTcDISNEY,cENc1966,cPOCOScMESEScANTEScDEcQUEcMURIERAcDEcC�CERcPULMONAR?c?c
[02:37] LibelulaBreve 1 Pista: ** ***** ** ** ***** Valor pregunta : 16817 Puntos [02:37] LibelulaBreve
1 Pista: ** ***** ** ** ***** Valor pregunta : 16817 Puntos
[02:37] LibelulaBreve 2 Pista: el�**** ** ** ***** 30 segundos y 16817 Puntos [02:37] LibelulaBreve
2 Pista: el�**** ** ** ***** 30 segundos y 16817 Puntos
[02:37] LibelulaBreve 3 Pista: el�i**o *e *a *e**a 15 segundos y 16817 Puntos [02:37] LibelulaBreve
3 Pista: el�i**o *e *a *e**a 15 segundos y 16817 Puntos
[02:38] LibelulaBreve Tiempo! La respuesta es -> el�ibro�e�a�elva <- [02:38] LibelulaBreve
Tiempo! La respuesta es -> el�ibro�e�a�elva <-
[02:38] LibelulaBreve Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [02:38] LibelulaBreve
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[02:38] LibelulaBreve Tri.10584 Idiomasɲaziel9˿FRANCES--->ESPA񏌺historiqueu?h [02:38] LibelulaBreve
Tri.10584 Idiomasɲaziel9˿FRANCES--->ESPA񏌺historiqueu?h
[02:38] LibelulaBreve 1 Pista: ********* Valor pregunta : 7368 Puntos [02:38] LibelulaBreve
1 Pista: ********* Valor pregunta : 7368 Puntos
[02:38] Gata_Suave historia [02:38] Gata_Suave
historia
[02:38] LibelulaBreve 2 Pista: his****** 30 segundos y 7368 Puntos [02:38] LibelulaBreve
2 Pista: his****** 30 segundos y 7368 Puntos
[02:38] Gata_Suave historica [02:38] Gata_Suave
historica
[02:38] LibelulaBreve 3 Pista: his*o*i*o 15 segundos y 7368 Puntos [02:38] LibelulaBreve
3 Pista: his*o*i*o 15 segundos y 7368 Puntos
[02:38] LibelulaBreve �Increible!! Gata_Suave contest󺠃04"historico" en �3.453 segundos, y ha ganado �368�12 puntos [02:38] LibelulaBreve
�Increible!! Gata_Suave contest󺠃04"historico" en �3.453 segundos, y ha ganado �368�12 puntos
[02:38] Gata_Suave historico [02:38] Gata_Suave
historico
[02:38] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:38] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:38] LibelulaBreve Gata_Suave has acertado 14 seguidas!! Puntos HOY: 933857, SEMANA: 933857 y MES: 933857 [02:38] LibelulaBreve
Gata_Suave has acertado 14 seguidas!! Puntos HOY: 933857, SEMANA: 933857 y MES: 933857
[02:39] LibelulaBreve Tri.5976 Politicaɓsurfer˿AequempaisnfuemelhPrimeraviajemOficialhdelhPrincipemdemAsturiasn?e [02:39] LibelulaBreve
Tri.5976 Politicaɓsurfer˿AequempaisnfuemelhPrimeraviajemOficialhdelhPrincipemdemAsturiasn?e
[02:39] LibelulaBreve 1 Pista: ******** Pregunta de BONUS : 25000 Puntos [02:39] LibelulaBreve
1 Pista: ******** Pregunta de BONUS : 25000 Puntos
[02:39] LibelulaBreve 2 Pista: col***** 30 segundos y 25000 Puntos [02:39] LibelulaBreve
2 Pista: col***** 30 segundos y 25000 Puntos
[02:39] LibelulaBreve 3 Pista: colo**ia 15 segundos y 25000 Puntos [02:39] LibelulaBreve
3 Pista: colo**ia 15 segundos y 25000 Puntos
[02:39] LibelulaBreve Tiempo! La respuesta es -> colombia <- [02:39] LibelulaBreve
Tiempo! La respuesta es -> colombia <-
[02:39] LibelulaBreve We feature over 50,000 Q&A ! [02:39] LibelulaBreve
We feature over 50,000 Q&A !
[02:39] LibelulaBreve Tri.16495 Fisica-QuimicaɐiNKiTa˿Comouseddenominantlasosalesoderivadasodeltoxidoudedplomou(iv)n?n [02:39] LibelulaBreve
Tri.16495 Fisica-QuimicaɐiNKiTa˿Comouseddenominantlasosalesoderivadasodeltoxidoudedplomou(iv)n?n
[02:39] LibelulaBreve 1 Pista: ********* Valor pregunta : 6041 Puntos [02:39] LibelulaBreve
1 Pista: ********* Valor pregunta : 6041 Puntos
[02:40] LibelulaBreve 2 Pista: plu****** 30 segundos y 6041 Puntos [02:40] LibelulaBreve
2 Pista: plu****** 30 segundos y 6041 Puntos
[02:40] LibelulaBreve 3 Pista: plu**a*o* 15 segundos y 6041 Puntos [02:40] LibelulaBreve
3 Pista: plu**a*o* 15 segundos y 6041 Puntos
[02:40] LibelulaBreve Tiempo! La respuesta es -> plumbatos <- [02:40] LibelulaBreve
Tiempo! La respuesta es -> plumbatos <-
[02:40] LibelulaBreve Tri.13237 Arteɓibila˿DONDEaESTAaELaMUSEOaLAZAROaGALDEANOa?a [02:40] LibelulaBreve
Tri.13237 Arteɓibila˿DONDEaESTAaELaMUSEOaLAZAROaGALDEANOa?a
[02:40] LibelulaBreve 1 Pista: ****** Valor pregunta : 24272 Puntos [02:40] LibelulaBreve
1 Pista: ****** Valor pregunta : 24272 Puntos
[02:41] LibelulaBreve 2 Pista: mad*** 30 segundos y 24272 Puntos [02:41] LibelulaBreve
2 Pista: mad*** 30 segundos y 24272 Puntos
[02:41] LibelulaBreve �e nota que sabes mucho de esto Gata_Suave! Tu respuesta "madrid" es correcta y ganas �4272�12 puntos [02:41] LibelulaBreve
�e nota que sabes mucho de esto Gata_Suave! Tu respuesta "madrid" es correcta y ganas �4272�12 puntos
[02:41] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:41] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:41] LibelulaBreve Gata_Suave has acertado 15 seguidas!! Puntos HOY: 958129, SEMANA: 958129 y MES: 958129 [02:41] LibelulaBreve
Gata_Suave has acertado 15 seguidas!! Puntos HOY: 958129, SEMANA: 958129 y MES: 958129
[02:41] Gata_Suave madrid [02:41] Gata_Suave
madrid
[02:41] LibelulaBreve Tri.12033 Geografiaɓebosin˿HonggKonggestჰ1lformadofporqlavislavdeeHonggKong,lloshnuevoshterritorioshyflavpen�ulavdee...?l?l [02:41] LibelulaBreve
Tri.12033 Geografiaɓebosin˿HonggKonggestჰ1lformadofporqlavislavdeeHonggKong,lloshnuevoshterritorioshyflavpen�ulavdee...?l?l
[02:41] LibelulaBreve 1 Pista: ******* Valor pregunta : 10717 Puntos [02:41] LibelulaBreve
1 Pista: ******* Valor pregunta : 10717 Puntos
[02:41] LibelulaBreve 2 Pista: kow**** 30 segundos y 10717 Puntos [02:41] LibelulaBreve
2 Pista: kow**** 30 segundos y 10717 Puntos
[02:41] Murcielago}Letal kowloon [02:41] Murcielago}Letal
kowloon
[02:41] LibelulaBreve �Murcielago}Letal acert󡡠La respuesta era: "kowloon" y contest󠥮 �7.313 segundos. Se lleva: �0717�12 puntos [02:41] LibelulaBreve
�Murcielago}Letal acert󡡠La respuesta era: "kowloon" y contest󠥮 �7.313 segundos. Se lleva: �0717�12 puntos
[02:41] LibelulaBreve ACTION awards Murcielago}Letal with a +v for having over 15000 points [02:41] LibelulaBreve
ACTION awards Murcielago}Letal with a +v for having over 15000 points
[02:41] LibelulaBreve Murcielago}Letal has acertado 1 seguidas!! Puntos HOY: 27747, SEMANA: 27747 y MES: 97473 [02:41] LibelulaBreve
Murcielago}Letal has acertado 1 seguidas!! Puntos HOY: 27747, SEMANA: 27747 y MES: 97473
[02:41] LibelulaBreve Please remember this is a FREE service, Please do not complain [02:41] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[02:41] LibelulaBreve Tri.5149 Historiaɳubmarin˿Dondeymuriofcraso?v?v [02:41] LibelulaBreve
Tri.5149 Historiaɳubmarin˿Dondeymuriofcraso?v?v
[02:41] LibelulaBreve 1 Pista: ****** Valor pregunta : 21079 Puntos [02:41] LibelulaBreve
1 Pista: ****** Valor pregunta : 21079 Puntos
[02:42] LibelulaBreve 2 Pista: car*** 30 segundos y 21079 Puntos [02:42] LibelulaBreve
2 Pista: car*** 30 segundos y 21079 Puntos
[02:42] LibelulaBreve 3 Pista: car*a* 15 segundos y 21079 Puntos [02:42] LibelulaBreve
3 Pista: car*a* 15 segundos y 21079 Puntos
[02:42] LibelulaBreve Tiempo! La respuesta es -> carras <- [02:42] LibelulaBreve
Tiempo! La respuesta es -> carras <-
[02:42] HormigaPedante CARVAL [02:42] HormigaPedante
CARVAL
[02:42] LibelulaBreve R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663 [02:42] LibelulaBreve
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663
[02:42] LibelulaBreve Tri.5345 DeporteɔDI˿ANTErQUErEQUIPOrDEBUTOrALBERTOrRIVERArENrPRIMERArDIVISIONrCONrELrREALrMADRIDr?r [02:42] LibelulaBreve
Tri.5345 DeporteɔDI˿ANTErQUErEQUIPOrDEBUTOrALBERTOrRIVERArENrPRIMERArDIVISIONrCONrELrREALrMADRIDr?r
[02:42] LibelulaBreve 1 Pista: ***** ** **** Valor pregunta : 20063 Puntos [02:42] LibelulaBreve
1 Pista: ***** ** **** Valor pregunta : 20063 Puntos
[02:43] LibelulaBreve 2 Pista: cel** ** **** 30 segundos y 20063 Puntos [02:43] LibelulaBreve
2 Pista: cel** ** **** 30 segundos y 20063 Puntos
[02:43] Gata_Suave celta de [02:43] Gata_Suave
celta de
[02:43] HormigaPedante celta mde vigo [02:43] HormigaPedante
celta mde vigo
[02:43] LibelulaBreve 3 Pista: cel*a *e *i*o 15 segundos y 20063 Puntos [02:43] LibelulaBreve
3 Pista: cel*a *e *i*o 15 segundos y 20063 Puntos
[02:43] HormigaPedante celta de vigo [02:43] HormigaPedante
celta de vigo
[02:43] LibelulaBreve �Muy bien HormigaPedante!! Acertaste "celta de vigo" en tan s󬯠�8.547 segundos y por eso has ganado: �0063�12 puntos [02:43] LibelulaBreve
�Muy bien HormigaPedante!! Acertaste "celta de vigo" en tan s󬯠�8.547 segundos y por eso has ganado: �0063�12 puntos
[02:43] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [02:43] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[02:43] LibelulaBreve HormigaPedante has acertado 1 seguidas!! Puntos HOY: 20063, SEMANA: 20063 y MES: 7246307 [02:43] LibelulaBreve
HormigaPedante has acertado 1 seguidas!! Puntos HOY: 20063, SEMANA: 20063 y MES: 7246307
[02:43] LibelulaBreve If you think a Q&A is wrong, please call an OP [02:43] LibelulaBreve
If you think a Q&A is wrong, please call an OP
[02:43] LibelulaBreve Tri.11317 HistoriaɊAVEA˿1937:CONTRAxQUExPAISxENTRAxENxGUERRAxCHINAx?x [02:43] LibelulaBreve
Tri.11317 HistoriaɊAVEA˿1937:CONTRAxQUExPAISxENTRAxENxGUERRAxCHINAx?x
[02:43] LibelulaBreve 1 Pista: ***** Valor pregunta : 22259 Puntos [02:43] LibelulaBreve
1 Pista: ***** Valor pregunta : 22259 Puntos
[02:43] Gata_Suave rusia [02:43] Gata_Suave
rusia
[02:43] LibelulaBreve 2 Pista: jap** 30 segundos y 22259 Puntos [02:43] LibelulaBreve
2 Pista: jap** 30 segundos y 22259 Puntos
[02:44] Gata_Suave japon [02:44] Gata_Suave
japon
[02:44] LibelulaBreve �Bien Gata_Suave!! Tu respuesta: "japon" es correcta y ganas �2259�12 puntos [02:44] LibelulaBreve
�Bien Gata_Suave!! Tu respuesta: "japon" es correcta y ganas �2259�12 puntos
[02:44] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:44] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:44] LibelulaBreve Gata_Suave has acertado 1 seguidas!! Puntos HOY: 980388, SEMANA: 980388 y MES: 980388 [02:44] LibelulaBreve
Gata_Suave has acertado 1 seguidas!! Puntos HOY: 980388, SEMANA: 980388 y MES: 980388
[02:44] LibelulaBreve R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708 [02:44] LibelulaBreve
R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708
[02:44] LibelulaBreve Tri.1476 Idiomasɴjmm.com˅ngingl鳺veleg鮥rojhumano,vlaaHumanidad.v?v [02:44] LibelulaBreve
Tri.1476 Idiomasɴjmm.com˅ngingl鳺veleg鮥rojhumano,vlaaHumanidad.v?v
[02:44] LibelulaBreve 1 Pista: ******* Valor pregunta : 8204 Puntos [02:44] LibelulaBreve
1 Pista: ******* Valor pregunta : 8204 Puntos
[02:44] LibelulaBreve 2 Pista: Man**** 30 segundos y 8204 Puntos [02:44] LibelulaBreve
2 Pista: Man**** 30 segundos y 8204 Puntos
[02:44] LibelulaBreve �Increible!! Murcielago}Letal contest󺠃04"mankind" en �2.938 segundos, y ha ganado �204�12 puntos [02:44] LibelulaBreve
�Increible!! Murcielago}Letal contest󺠃04"mankind" en �2.938 segundos, y ha ganado �204�12 puntos
[02:44] LibelulaBreve ACTION awards Murcielago}Letal with a +v for having over 15000 points [02:44] LibelulaBreve
ACTION awards Murcielago}Letal with a +v for having over 15000 points
[02:44] LibelulaBreve Murcielago}Letal has acertado 1 seguidas!! Puntos HOY: 35951, SEMANA: 35951 y MES: 105677 [02:44] LibelulaBreve
Murcielago}Letal has acertado 1 seguidas!! Puntos HOY: 35951, SEMANA: 35951 y MES: 105677
[02:44] Murcielago}Letal mankind [02:44] Murcielago}Letal
mankind
[02:44] HormigaPedante mankind [02:44] HormigaPedante
mankind
[02:44] LibelulaBreve For The Competitive Edge type !pingme [02:44] LibelulaBreve
For The Competitive Edge type !pingme
[02:44] LibelulaBreve Tri.3863 Arteɨelvetis˿C󭯃01pseqllamantlashtreshparteshentqueqseqdividequnaycolumnay?q [02:44] LibelulaBreve
Tri.3863 Arteɨelvetis˿C󭯃01pseqllamantlashtreshparteshentqueqseqdividequnaycolumnay?q
[02:44] LibelulaBreve 1 Pista: **** ***** * ******* Valor pregunta : 5745 Puntos [02:44] LibelulaBreve
1 Pista: **** ***** * ******* Valor pregunta : 5745 Puntos
[02:44] HormigaPedante humankin [02:44] HormigaPedante
humankin
[02:44] LibelulaBreve 2 Pista: bas* ***** * ******* 30 segundos y 5745 Puntos [02:44] LibelulaBreve
2 Pista: bas* ***** * ******* 30 segundos y 5745 Puntos
[02:45] Gata_Suave dorsal lumbar y cervical [02:45] Gata_Suave
dorsal lumbar y cervical
[02:45] LibelulaBreve 3 Pista: basa *u**e * *a*i*e* 15 segundos y 5745 Puntos [02:45] LibelulaBreve
3 Pista: basa *u**e * *a*i*e* 15 segundos y 5745 Puntos
[02:45] LibelulaBreve Tiempo! La respuesta es -> basa�uste��apitel <- [02:45] LibelulaBreve
Tiempo! La respuesta es -> basa�uste��apitel <-
[02:45] LibelulaBreve Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [02:45] LibelulaBreve
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[02:45] LibelulaBreve Tri.10881 MitologiaɍARdeJAVA˿AwQUɃ01wMITOLOǴwPERTENECEwELwDIOSwDELwSOLwINTI?w?w [02:45] LibelulaBreve
Tri.10881 MitologiaɍARdeJAVA˿AwQUɃ01wMITOLOǴwPERTENECEwELwDIOSwDELwSOLwINTI?w?w
[02:45] LibelulaBreve 1 Pista: **** Valor pregunta : 10534 Puntos [02:45] LibelulaBreve
1 Pista: **** Valor pregunta : 10534 Puntos
[02:45] HormigaPedante inca [02:45] HormigaPedante
inca
[02:45] LibelulaBreve �Est᳠que lo tiras HormigaPedante!! ߃󭯠supiste que "inca" era la respuesta? Venga, �0534�12 puntos suben a tu marcador [02:45] LibelulaBreve
�Est᳠que lo tiras HormigaPedante!! ߃󭯠supiste que "inca" era la respuesta? Venga, �0534�12 puntos suben a tu marcador
[02:45] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [02:45] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[02:45] LibelulaBreve HormigaPedante has acertado 1 seguidas!! Puntos HOY: 30597, SEMANA: 30597 y MES: 7256841 [02:45] LibelulaBreve
HormigaPedante has acertado 1 seguidas!! Puntos HOY: 30597, SEMANA: 30597 y MES: 7256841
[02:46] LibelulaBreve R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7246307 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: Gata_Suave 980388 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404 [02:46] LibelulaBreve
R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7246307 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: Gata_Suave 980388 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404
[02:46] LibelulaBreve Tri.766 CineɁrtea˿DegcuantoxeraheljasesinatoxprotagonizadoxpormNicolasbCageg?k [02:46] LibelulaBreve
Tri.766 CineɁrtea˿DegcuantoxeraheljasesinatoxprotagonizadoxpormNicolasbCageg?k
[02:46] LibelulaBreve 1 Pista: * ** Valor pregunta : 10174 Puntos [02:46] LibelulaBreve
1 Pista: * ** Valor pregunta : 10174 Puntos
[02:46] LibelulaBreve 2 Pista: 8�* 30 segundos y 10174 Puntos [02:46] LibelulaBreve
2 Pista: 8�* 30 segundos y 10174 Puntos
[02:46] Gata_Suave 8 mm [02:46] Gata_Suave
8 mm
[02:46] LibelulaBreve �e nota que sabes mucho de esto Gata_Suave! Tu respuesta "8 mm" es correcta y ganas �0174�12 puntos [02:46] LibelulaBreve
�e nota que sabes mucho de esto Gata_Suave! Tu respuesta "8 mm" es correcta y ganas �0174�12 puntos
[02:46] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:46] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:46] LibelulaBreve Gata_Suave has acertado 1 seguidas!! Puntos HOY: 990562, SEMANA: 990562 y MES: 990562 [02:46] LibelulaBreve
Gata_Suave has acertado 1 seguidas!! Puntos HOY: 990562, SEMANA: 990562 y MES: 990562
[02:46] LibelulaBreve Please refrain from using Extreme Bad Language [02:46] LibelulaBreve
Please refrain from using Extreme Bad Language
[02:46] LibelulaBreve Tri.14536 MiscelaneaɔeLaRaNhA˿Elsqueymuchorhablac?u [02:46] LibelulaBreve
Tri.14536 MiscelaneaɔeLaRaNhA˿Elsqueymuchorhablac?u
[02:46] LibelulaBreve 1 Pista: ***** ***** Valor pregunta : 21018 Puntos [02:46] LibelulaBreve
1 Pista: ***** ***** Valor pregunta : 21018 Puntos
[02:46] Murcielago}Letal Gallina_SinRespeto: saludos bro [02:46] Murcielago}Letal
Gallina_SinRespeto: saludos bro
[02:46] LibelulaBreve 2 Pista: muc** ***** 30 segundos y 21018 Puntos [02:46] LibelulaBreve
2 Pista: muc** ***** 30 segundos y 21018 Puntos
[02:46] HormigaPedante poco sabe [02:46] HormigaPedante
poco sabe
[02:46] Gata_Suave mucho calla [02:46] Gata_Suave
mucho calla
[02:46] Gallina_SinRespeto Murcielago}Letal buenas bro 🍺 [02:46] Gallina_SinRespeto
Murcielago}Letal buenas bro 🍺
[02:47] LibelulaBreve 3 Pista: muc*o *e**a 15 segundos y 21018 Puntos [02:47] LibelulaBreve
3 Pista: muc*o *e**a 15 segundos y 21018 Puntos
[02:47] LibelulaBreve �Suma y sigue HormigaPedante!! La respuesta: "mucho yerra" incrementa tu marcador en �1018�12 puntos [02:47] LibelulaBreve
�Suma y sigue HormigaPedante!! La respuesta: "mucho yerra" incrementa tu marcador en �1018�12 puntos
[02:47] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [02:47] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[02:47] LibelulaBreve HormigaPedante has acertado 1 seguidas!! Puntos HOY: 51615, SEMANA: 51615 y MES: 7277859 [02:47] LibelulaBreve
HormigaPedante has acertado 1 seguidas!! Puntos HOY: 51615, SEMANA: 51615 y MES: 7277859
[02:47] Gallina_SinRespeto que milagro [02:47] Gallina_SinRespeto
que milagro
[02:47] HormigaPedante mucho yerra [02:47] HormigaPedante
mucho yerra
[02:47] LibelulaBreve This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve [02:47] LibelulaBreve
This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve
[02:47] LibelulaBreve Tri.16191 Mitologiaɴjmm.com˿ElnhijopdeyPerseopgobern󃰱raflosqpersas,raflosqqueydiopnombre,rykseyllamaba...r?r [02:47] LibelulaBreve
Tri.16191 Mitologiaɴjmm.com˿ElnhijopdeyPerseopgobern󃰱raflosqpersas,raflosqqueydiopnombre,rykseyllamaba...r?r
[02:47] LibelulaBreve 1 Pista: ****** Valor pregunta : 16340 Puntos [02:47] LibelulaBreve
1 Pista: ****** Valor pregunta : 16340 Puntos
[02:47] LibelulaBreve 2 Pista: per*** 30 segundos y 16340 Puntos [02:47] LibelulaBreve
2 Pista: per*** 30 segundos y 16340 Puntos
[02:47] HormigaPedante zeus [02:47] HormigaPedante
zeus
[02:47] HormigaPedante danae [02:47] HormigaPedante
danae
[02:47] LibelulaBreve 3 Pista: per*e* 15 segundos y 16340 Puntos [02:47] LibelulaBreve
3 Pista: per*e* 15 segundos y 16340 Puntos
[02:47] Gata_Suave perseo [02:47] Gata_Suave
perseo
[02:48] LibelulaBreve Tiempo! La respuesta es -> perses <- [02:48] LibelulaBreve
Tiempo! La respuesta es -> perses <-
[02:48] Murcielago}Letal Gallina_SinRespeto: Este juego es difícil para mí porque no puedo hablarespanol :P [02:48] Murcielago}Letal
Gallina_SinRespeto: Este juego es difícil para mí porque no puedo hablarespanol :P
[02:48] LibelulaBreve This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [02:48] LibelulaBreve
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[02:48] LibelulaBreve Tri.7315 Biologiaɪcrazy_Sp˿EstructurawdelwAcidofdesoxirribonicleicof?a [02:48] LibelulaBreve
Tri.7315 Biologiaɪcrazy_Sp˿EstructurawdelwAcidofdesoxirribonicleicof?a
[02:48] LibelulaBreve 1 Pista: ***** ****** Valor pregunta : 21497 Puntos [02:48] LibelulaBreve
1 Pista: ***** ****** Valor pregunta : 21497 Puntos
[02:48] LibelulaBreve 2 Pista: dob** ****** 30 segundos y 21497 Puntos [02:48] LibelulaBreve
2 Pista: dob** ****** 30 segundos y 21497 Puntos
[02:48] HormigaPedante no importa [02:48] HormigaPedante
no importa
[02:48] LibelulaBreve 3 Pista: dob*e *e*i*e 15 segundos y 21497 Puntos [02:48] LibelulaBreve
3 Pista: dob*e *e*i*e 15 segundos y 21497 Puntos
[02:48] Gallina_SinRespeto Murcielago}Letal yo mejor le doy ignore porque no me sé las respuestas XD [02:48] Gallina_SinRespeto
Murcielago}Letal yo mejor le doy ignore porque no me sé las respuestas XD
[02:48] LibelulaBreve Tiempo! La respuesta es -> doble�elice <- [02:48] LibelulaBreve
Tiempo! La respuesta es -> doble�elice <-
[02:49] LibelulaBreve Please remember this is a FREE service, Please do not complain [02:49] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[02:49] LibelulaBreve Tri.4274 Cancionesɴarra˿Deqquienaesq"Theqtimesqtheyhareqa-changin'z"?z?z [02:49] LibelulaBreve
Tri.4274 Cancionesɴarra˿Deqquienaesq"Theqtimesqtheyhareqa-changin'z"?z?z
[02:49] LibelulaBreve 1 Pista: *** ***** Valor pregunta : 16378 Puntos [02:49] LibelulaBreve
1 Pista: *** ***** Valor pregunta : 16378 Puntos
[02:49] Hormiga\Rapaz Jajajajajajas ruben_mty- , saludos [02:49] Hormiga\Rapaz
Jajajajajajas ruben_mty- , saludos
[02:49] LibelulaBreve 2 Pista: bob ***** 30 segundos y 16378 Puntos [02:49] LibelulaBreve
2 Pista: bob ***** 30 segundos y 16378 Puntos
[02:49] Murcielago}Letal Gallina_SinRespeto: lol [02:49] Murcielago}Letal
Gallina_SinRespeto: lol
[02:49] Gallina_SinRespeto Hormiga\Rapaz saludos man [02:49] Gallina_SinRespeto
Hormiga\Rapaz saludos man
[02:49] Gata_Suave bob marley [02:49] Gata_Suave
bob marley
[02:49] HormigaPedante bob dylan [02:49] HormigaPedante
bob dylan
[02:49] LibelulaBreve �Enhorabuena HormigaPedante!! Has contestado "bob dylan" y por ello has ganado �6378�12 puntos [02:49] LibelulaBreve
�Enhorabuena HormigaPedante!! Has contestado "bob dylan" y por ello has ganado �6378�12 puntos
[02:49] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [02:49] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[02:49] LibelulaBreve HormigaPedante has acertado 2 seguidas!! Puntos HOY: 67993, SEMANA: 67993 y MES: 7294237 [02:49] LibelulaBreve
HormigaPedante has acertado 2 seguidas!! Puntos HOY: 67993, SEMANA: 67993 y MES: 7294237
[02:49] Hormiga\Rapaz Saludos Wilby [02:49] Hormiga\Rapaz
Saludos Wilby
[02:49] LibelulaBreve This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 105677 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065 [02:49] LibelulaBreve
This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 105677 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065
[02:49] LibelulaBreve Tri.2508 Biologiaɪcrazy_Sp˿EstableciorlallinealdivisorialzoologicalengelzsiglorXIXz?z [02:49] LibelulaBreve
Tri.2508 Biologiaɪcrazy_Sp˿EstableciorlallinealdivisorialzoologicalengelzsiglorXIXz?z
[02:49] LibelulaBreve 1 Pista: ****** ****** ******* Valor pregunta : 8154 Puntos [02:49] LibelulaBreve
1 Pista: ****** ****** ******* Valor pregunta : 8154 Puntos
[02:49] Murcielago}Letal Hormiga\Rapaz: saludos [02:49] Murcielago}Letal
Hormiga\Rapaz: saludos
[02:49] LibelulaBreve 2 Pista: alf*** ****** ******* 30 segundos y 8154 Puntos [02:49] LibelulaBreve
2 Pista: alf*** ****** ******* 30 segundos y 8154 Puntos
[02:50] HormigaPedante alfred russel wallace [02:50] HormigaPedante
alfred russel wallace
[02:50] LibelulaBreve �Increible!! HormigaPedante contest󺠃04"alfred russel wallace" en �7.453 segundos, y ha ganado �154�12 puntos [02:50] LibelulaBreve
�Increible!! HormigaPedante contest󺠃04"alfred russel wallace" en �7.453 segundos, y ha ganado �154�12 puntos
[02:50] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [02:50] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[02:50] LibelulaBreve HormigaPedante has acertado 3 seguidas!! Puntos HOY: 76147, SEMANA: 76147 y MES: 7302391 [02:50] LibelulaBreve
HormigaPedante has acertado 3 seguidas!! Puntos HOY: 76147, SEMANA: 76147 y MES: 7302391
[02:50] LibelulaBreve R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 [02:50] LibelulaBreve
R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244
[02:50] LibelulaBreve Tri.17780 GeografiaɍARdeJAVA˿ENyQUɃ01yPA͓ySEyENCUENTRANyLASyREPڂLICASyFEDERADASyDEyYAKUTIA-SAJA,yADIGUESIA,yKARACH�-CHERKESIA?y?y [02:50] LibelulaBreve
Tri.17780 GeografiaɍARdeJAVA˿ENyQUɃ01yPA͓ySEyENCUENTRANyLASyREPڂLICASyFEDERADASyDEyYAKUTIA-SAJA,yADIGUESIA,yKARACH�-CHERKESIA?y?y
[02:50] LibelulaBreve 1 Pista: ***** Valor pregunta : 15590 Puntos [02:50] LibelulaBreve
1 Pista: ***** Valor pregunta : 15590 Puntos
[02:50] LibelulaBreve 2 Pista: rus** 30 segundos y 15590 Puntos [02:50] LibelulaBreve
2 Pista: rus** 30 segundos y 15590 Puntos
[02:50] Gata_Suave rusia [02:50] Gata_Suave
rusia
[02:50] LibelulaBreve �Bien Gata_Suave!! Tu respuesta: "rusia" es correcta y ganas �5590�12 puntos [02:50] LibelulaBreve
�Bien Gata_Suave!! Tu respuesta: "rusia" es correcta y ganas �5590�12 puntos
[02:50] LibelulaBreve ACTION Aplausos Gata_Suave una cerveza fr�por 1000000 victorias!! Ole Gata_Suave!!! [02:50] LibelulaBreve
ACTION Aplausos Gata_Suave una cerveza fr�por 1000000 victorias!! Ole Gata_Suave!!!
[02:50] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:50] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:50] LibelulaBreve Gata_Suave has acertado 1 seguidas!! Puntos HOY: 1006152, SEMANA: 1006152 y MES: 1006152 [02:50] LibelulaBreve
Gata_Suave has acertado 1 seguidas!! Puntos HOY: 1006152, SEMANA: 1006152 y MES: 1006152
[02:50] HormigaPedante rusia [02:50] HormigaPedante
rusia
[02:50] LibelulaBreve Top10 Players ( Weekly & Monthly ) are Auto-Voiced [02:50] LibelulaBreve
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[02:50] LibelulaBreve Tri.16462 Fisica-QuimicaɊAVEA˿1924:zQUEzNOMBREzRECIBEzLAz4ʃ01zMATERIAzQUEzPRECONIZANzSUzEXISTENCIAzPORzPARTEzDEzEINSTEINzYzNATHzBOSEz(COMPROBADAz71zAяSzDESPUES)z?z [02:50] LibelulaBreve
Tri.16462 Fisica-QuimicaɊAVEA˿1924:zQUEzNOMBREzRECIBEzLAz4ʃ01zMATERIAzQUEzPRECONIZANzSUzEXISTENCIAzPORzPARTEzDEzEINSTEINzYzNATHzBOSEz(COMPROBADAz71zAяSzDESPUES)z?z
[02:50] LibelulaBreve 1 Pista: ****** Valor pregunta : 8345 Puntos [02:50] LibelulaBreve
1 Pista: ****** Valor pregunta : 8345 Puntos
[02:51] LibelulaBreve 2 Pista: pla*** 30 segundos y 8345 Puntos [02:51] LibelulaBreve
2 Pista: pla*** 30 segundos y 8345 Puntos
[02:51] Gata_Suave plasma [02:51] Gata_Suave
plasma
[02:51] LibelulaBreve �Est᳠que lo tiras Gata_Suave!! ߃󭯠supiste que "plasma" era la respuesta? Venga, �345�12 puntos suben a tu marcador [02:51] LibelulaBreve
�Est᳠que lo tiras Gata_Suave!! ߃󭯠supiste que "plasma" era la respuesta? Venga, �345�12 puntos suben a tu marcador
[02:51] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:51] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:51] LibelulaBreve Gata_Suave has acertado 2 seguidas!! Puntos HOY: 1014497, SEMANA: 1014497 y MES: 1014497 [02:51] LibelulaBreve
Gata_Suave has acertado 2 seguidas!! Puntos HOY: 1014497, SEMANA: 1014497 y MES: 1014497
[02:51] HormigaPedante plasma [02:51] HormigaPedante
plasma
[02:51] LibelulaBreve Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [02:51] LibelulaBreve
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[02:51] LibelulaBreve Tri.17544 Literaturaɭeji˿Autoraden"cromosomay6"d?d [02:51] LibelulaBreve
Tri.17544 Literaturaɭeji˿Autoraden"cromosomay6"d?d
[02:51] LibelulaBreve 1 Pista: ***** **** Valor pregunta : 12215 Puntos [02:51] LibelulaBreve
1 Pista: ***** **** Valor pregunta : 12215 Puntos
[02:51] LibelulaBreve 2 Pista: rob** **** 30 segundos y 12215 Puntos [02:51] LibelulaBreve
2 Pista: rob** **** 30 segundos y 12215 Puntos
[02:51] LibelulaBreve �e nota que sabes mucho de esto HormigaPedante! Tu respuesta "robin cook" es correcta y ganas �2215�12 puntos [02:51] LibelulaBreve
�e nota que sabes mucho de esto HormigaPedante! Tu respuesta "robin cook" es correcta y ganas �2215�12 puntos
[02:51] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [02:51] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[02:51] LibelulaBreve HormigaPedante has acertado 1 seguidas!! Puntos HOY: 88362, SEMANA: 88362 y MES: 7314606 [02:51] LibelulaBreve
HormigaPedante has acertado 1 seguidas!! Puntos HOY: 88362, SEMANA: 88362 y MES: 7314606
[02:51] HormigaPedante robin cook [02:51] HormigaPedante
robin cook
[02:51] LibelulaBreve Tri.16494 InformaticaɞLorien^˿(broma)jLosudecmicrosoftqcometieronuunuerroritipogrᦩcoxallescribiri"plugxandwplay",jquecdeber�uhaberipuestoxenurealidadw?j [02:51] LibelulaBreve
Tri.16494 InformaticaɞLorien^˿(broma)jLosudecmicrosoftqcometieronuunuerroritipogrᦩcoxallescribiri"plugxandwplay",jquecdeber�uhaberipuestoxenurealidadw?j
[02:51] LibelulaBreve 1 Pista: **** *** **** Valor pregunta : 6543 Puntos [02:51] LibelulaBreve
1 Pista: **** *** **** Valor pregunta : 6543 Puntos
[02:52] LibelulaBreve 2 Pista: plu* *** **** 30 segundos y 6543 Puntos [02:52] LibelulaBreve
2 Pista: plu* *** **** 30 segundos y 6543 Puntos
[02:52] LibelulaBreve 3 Pista: plu* a** **a* 15 segundos y 6543 Puntos [02:52] LibelulaBreve
3 Pista: plu* a** **a* 15 segundos y 6543 Puntos
[02:52] Gata_Suave plug and play [02:52] Gata_Suave
plug and play
[02:52] LibelulaBreve Tiempo! La respuesta es -> plug�nd�ray <- [02:52] LibelulaBreve
Tiempo! La respuesta es -> plug�nd�ray <-
[02:52] Murcielago}Letal haha [02:52] Murcielago}Letal
haha
[02:52] LibelulaBreve We feature over 50,000 Q&A ! [02:52] LibelulaBreve
We feature over 50,000 Q&A !
[02:52] LibelulaBreve Tri.11233 DeporteɔDI˿CUALbERAbELbNOMBREbDEbPILAbDEbQUINCOCESb?b [02:52] LibelulaBreve
Tri.11233 DeporteɔDI˿CUALbERAbELbNOMBREbDEbPILAbDEbQUINCOCESb?b
[02:52] LibelulaBreve 1 Pista: ******* Valor pregunta : 16747 Puntos [02:52] LibelulaBreve
1 Pista: ******* Valor pregunta : 16747 Puntos
[02:53] HormigaPedante aisin [02:53] HormigaPedante
aisin
[02:53] LibelulaBreve 2 Pista: jac**** 30 segundos y 16747 Puntos [02:53] LibelulaBreve
2 Pista: jac**** 30 segundos y 16747 Puntos
[02:53] Gata_Suave jacques [02:53] Gata_Suave
jacques
[02:53] Caiman{Sensible [Gallina_SinRespeto] holaa [02:53] Caiman{Sensible
[Gallina_SinRespeto] holaa
[02:53] LibelulaBreve 3 Pista: jaci**o 15 segundos y 16747 Puntos [02:53] LibelulaBreve
3 Pista: jaci**o 15 segundos y 16747 Puntos
[02:53] LibelulaBreve �Ol頃04Gata_Suave!! Has contestado: "jacinto" en �6.906 segundos y sumas �6747�12 puntos a tu marcador. �Sigue as� [02:53] LibelulaBreve
�Ol頃04Gata_Suave!! Has contestado: "jacinto" en �6.906 segundos y sumas �6747�12 puntos a tu marcador. �Sigue as�
[02:53] Gata_Suave jacinto [02:53] Gata_Suave
jacinto
[02:53] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:53] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:53] LibelulaBreve Gata_Suave has acertado 1 seguidas!! Puntos HOY: 1031244, SEMANA: 1031244 y MES: 1031244 [02:53] LibelulaBreve
Gata_Suave has acertado 1 seguidas!! Puntos HOY: 1031244, SEMANA: 1031244 y MES: 1031244
[02:53] HormigaPedante jacinto [02:53] HormigaPedante
jacinto
[02:53] Caiman{Sensible ya nadie es fan jajaja [02:53] Caiman{Sensible
ya nadie es fan jajaja
[02:53] LibelulaBreve Tri.5862 CancionesɓTAMPID˿Demquieniesrlaccancioni"CLEOPATRA"SiTHEME"i?i [02:53] LibelulaBreve
Tri.5862 CancionesɓTAMPID˿Demquieniesrlaccancioni"CLEOPATRA"SiTHEME"i?i
[02:53] LibelulaBreve 1 Pista: ********* Valor pregunta : 11879 Puntos [02:53] LibelulaBreve
1 Pista: ********* Valor pregunta : 11879 Puntos
[02:53] LibelulaBreve 2 Pista: cle****** 30 segundos y 11879 Puntos [02:53] LibelulaBreve
2 Pista: cle****** 30 segundos y 11879 Puntos
[02:54] LibelulaBreve 3 Pista: cleo*a**a 15 segundos y 11879 Puntos [02:54] LibelulaBreve
3 Pista: cleo*a**a 15 segundos y 11879 Puntos
[02:54] LibelulaBreve �Est᳠que lo tiras Gata_Suave!! ߃󭯠supiste que "cleopatra" era la respuesta? Venga, �1879�12 puntos suben a tu marcador [02:54] LibelulaBreve
�Est᳠que lo tiras Gata_Suave!! ߃󭯠supiste que "cleopatra" era la respuesta? Venga, �1879�12 puntos suben a tu marcador
[02:54] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [02:54] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[02:54] LibelulaBreve Gata_Suave has acertado 2 seguidas!! Puntos HOY: 1043123, SEMANA: 1043123 y MES: 1043123 [02:54] LibelulaBreve
Gata_Suave has acertado 2 seguidas!! Puntos HOY: 1043123, SEMANA: 1043123 y MES: 1043123
[02:54] Gata_Suave cleopatra [02:54] Gata_Suave
cleopatra
[02:54] LibelulaBreve Tri.14267 Deporteɡlamut˿DegquegciudadnllegaronuajLossAngelesslosscelebressLakers?.z?z [02:54] LibelulaBreve
Tri.14267 Deporteɡlamut˿DegquegciudadnllegaronuajLossAngelesslosscelebressLakers?.z?z
[02:54] LibelulaBreve 1 Pista: *********** Valor pregunta : 14273 Puntos [02:54] LibelulaBreve
1 Pista: *********** Valor pregunta : 14273 Puntos
[02:54] LibelulaBreve 2 Pista: min******** 30 segundos y 14273 Puntos [02:54] LibelulaBreve
2 Pista: min******** 30 segundos y 14273 Puntos
[02:54] Gata_Suave minessota [02:54] Gata_Suave
minessota
[02:54] Gallina_SinRespeto Caiman{Sensible buenassss [02:54] Gallina_SinRespeto
Caiman{Sensible buenassss
[02:54] LibelulaBreve �HormigaPedante acert󡡠La respuesta era: "minneapolis" y contest󠥮 �4.938 segundos. Se lleva: �4273�12 puntos [02:54] LibelulaBreve
�HormigaPedante acert󡡠La respuesta era: "minneapolis" y contest󠥮 �4.938 segundos. Se lleva: �4273�12 puntos
[02:54] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [02:54] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[02:54] LibelulaBreve HormigaPedante has acertado 1 seguidas!! Puntos HOY: 102635, SEMANA: 102635 y MES: 7328879 [02:54] LibelulaBreve
HormigaPedante has acertado 1 seguidas!! Puntos HOY: 102635, SEMANA: 102635 y MES: 7328879
[02:54] HormigaPedante minneapolis [02:54] HormigaPedante
minneapolis
[02:54] Caiman{Sensible tanto tiempo [02:54] Caiman{Sensible
tanto tiempo
[02:55] LibelulaBreve Please remember this is a FREE service, Please do not complain [02:55] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[02:55] LibelulaBreve Tri.2173 Arteɔhot˿Enkquexciudadbindiajestჰ1yelltaj-mahall?y [02:55] LibelulaBreve
Tri.2173 Arteɔhot˿Enkquexciudadbindiajestჰ1yelltaj-mahall?y
[02:55] LibelulaBreve 1 Pista: **** Valor pregunta : 15124 Puntos [02:55] LibelulaBreve
1 Pista: **** Valor pregunta : 15124 Puntos
[02:55] Gallina_SinRespeto seee [02:55] Gallina_SinRespeto
seee
[02:55] Gallina_SinRespeto ya llovió [02:55] Gallina_SinRespeto
ya llovió
[02:55] LibelulaBreve �Bien HormigaPedante!! Tu respuesta: "agra" es correcta y ganas �5124�12 puntos [02:55] LibelulaBreve
�Bien HormigaPedante!! Tu respuesta: "agra" es correcta y ganas �5124�12 puntos
[02:55] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [02:55] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[02:55] LibelulaBreve HormigaPedante has acertado 2 seguidas!! Puntos HOY: 117759, SEMANA: 117759 y MES: 7344003 [02:55] LibelulaBreve
HormigaPedante has acertado 2 seguidas!! Puntos HOY: 117759, SEMANA: 117759 y MES: 7344003
[02:55] HormigaPedante agra [02:55] HormigaPedante
agra
[02:55] Caiman{Sensible si [02:55] Caiman{Sensible
si
[02:55] Caiman{Sensible todo el dia [02:55] Caiman{Sensible
todo el dia
[02:55] LibelulaBreve R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663 [02:55] LibelulaBreve
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663
[02:55] LibelulaBreve Tri.14231 Musicaɖivian˿Dewquiensesvelaalbuma"Admisvni񯳃01vdew30da񯳢d?d [02:55] LibelulaBreve
Tri.14231 Musicaɖivian˿Dewquiensesvelaalbuma"Admisvni񯳃01vdew30da񯳢d?d
[02:55] LibelulaBreve 1 Pista: ****** Valor pregunta : 8313 Puntos [02:55] LibelulaBreve
1 Pista: ****** Valor pregunta : 8313 Puntos
[02:55] Caiman{Sensible [Jirafa}Fugaz] :O [02:55] Caiman{Sensible
[Jirafa}Fugaz] :O
[02:55] LibelulaBreve 2 Pista: mil*** 30 segundos y 8313 Puntos [02:55] LibelulaBreve
2 Pista: mil*** 30 segundos y 8313 Puntos
[02:55] Gallina_SinRespeto Caiman{Sensible cómo has estado? [02:55] Gallina_SinRespeto
Caiman{Sensible cómo has estado?
[02:55] HormigaPedante emilio [02:55] HormigaPedante
emilio
[02:55] Murcielago}Letal saludos Jirafa}Fugaz [02:55] Murcielago}Letal
saludos Jirafa}Fugaz
[02:55] Hormiga\Rapaz Pide tu membresía Caiman{Sensible que quieres seguir siendo fan XD [02:55] Hormiga\Rapaz
Pide tu membresía Caiman{Sensible que quieres seguir siendo fan XD
[02:55] Caiman{Sensible [Gallina_SinRespeto] bien y tu? [02:55] Caiman{Sensible
[Gallina_SinRespeto] bien y tu?
[02:55] LibelulaBreve 3 Pista: mili*i 15 segundos y 8313 Puntos [02:55] LibelulaBreve
3 Pista: mili*i 15 segundos y 8313 Puntos
[02:55] Gallina_SinRespeto espia01 buenas [02:55] Gallina_SinRespeto
espia01 buenas
[02:56] Caiman{Sensible [Hormiga\Rapaz] hay no,pa k ya [02:56] Caiman{Sensible
[Hormiga\Rapaz] hay no,pa k ya
[02:56] LibelulaBreve Tiempo! La respuesta es -> miliki <- [02:56] LibelulaBreve
Tiempo! La respuesta es -> miliki <-
[02:56] Gallina_SinRespeto Caiman{Sensible que bueno, yo bien también [02:56] Gallina_SinRespeto
Caiman{Sensible que bueno, yo bien también
[02:56] Caiman{Sensible [Hormiga\Rapaz] luego tengo k pagar [02:56] Caiman{Sensible
[Hormiga\Rapaz] luego tengo k pagar
[02:56] LibelulaBreve If you think a Q&A is wrong, please call an OP [02:56] LibelulaBreve
If you think a Q&A is wrong, please call an OP
[02:56] LibelulaBreve Tri.20092 Mitologiaɐsico666ˡnimalyfabuloso,wtotalmentexblanco,wcontcabezaryfpatasmdexcaballooyfuntlargoocuernoorectoosituadooentmedioodexsuzfrente.herᬤicar?w [02:56] LibelulaBreve
Tri.20092 Mitologiaɐsico666ˡnimalyfabuloso,wtotalmentexblanco,wcontcabezaryfpatasmdexcaballooyfuntlargoocuernoorectoosituadooentmedioodexsuzfrente.herᬤicar?w
[02:56] LibelulaBreve 1 Pista: ********* Valor pregunta : 8618 Puntos [02:56] LibelulaBreve
1 Pista: ********* Valor pregunta : 8618 Puntos
[02:56] Hormiga\Rapaz Jajajajajajajajaa Caiman{Sensible [02:56] Hormiga\Rapaz
Jajajajajajajajaa Caiman{Sensible
[02:56] Gallina_SinRespeto son fans de LibelulaBreve? [02:56] Gallina_SinRespeto
son fans de LibelulaBreve?
[02:56] LibelulaBreve 2 Pista: uni****** 30 segundos y 8618 Puntos [02:56] LibelulaBreve
2 Pista: uni****** 30 segundos y 8618 Puntos
[02:56] Caiman{Sensible no [02:56] Caiman{Sensible
no
[02:56] HormigaPedante milikiunicornio [02:56] HormigaPedante
milikiunicornio
[02:56] Caiman{Sensible yo lo tengo ignore [02:56] Caiman{Sensible
yo lo tengo ignore
[02:56] HormigaPedante unicornico [02:56] HormigaPedante
unicornico
[02:56] Hormiga\Rapaz Yo lo tengo en ignore a manito [02:56] Hormiga\Rapaz
Yo lo tengo en ignore a manito
[02:56] LibelulaBreve 3 Pista: uni*o**io 15 segundos y 8618 Puntos [02:56] LibelulaBreve
3 Pista: uni*o**io 15 segundos y 8618 Puntos
[02:56] Gallina_SinRespeto yo también jejejje [02:56] Gallina_SinRespeto
yo también jejejje
[02:56] HormigaPedante uncorio [02:56] HormigaPedante
uncorio
[02:57] Caiman{Sensible nadie lo kiere pobechito jaajja [02:57] Caiman{Sensible
nadie lo kiere pobechito jaajja
[02:57] HormigaPedante unicornio [02:57] HormigaPedante
unicornio
[02:57] LibelulaBreve �As�e hace HormigaPedante!! Contestaste "unicornio" en �4.531 segundos y sumas �618�12 puntos [02:57] LibelulaBreve
�As�e hace HormigaPedante!! Contestaste "unicornio" en �4.531 segundos y sumas �618�12 puntos
[02:57] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [02:57] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[02:57] LibelulaBreve HormigaPedante has acertado 3 seguidas!! Puntos HOY: 126377, SEMANA: 126377 y MES: 7352621 [02:57] LibelulaBreve
HormigaPedante has acertado 3 seguidas!! Puntos HOY: 126377, SEMANA: 126377 y MES: 7352621
[02:57] Gallina_SinRespeto hace muchas preguntas [02:57] Gallina_SinRespeto
hace muchas preguntas
[02:57] LibelulaBreve R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708 [02:57] LibelulaBreve
R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708
[02:57] LibelulaBreve Tri.10072 Idiomasɓebosin˿Diccionario-Qu郰1desfunhbaladro?d?d [02:57] LibelulaBreve
Tri.10072 Idiomasɓebosin˿Diccionario-Qu郰1desfunhbaladro?d?d
[02:57] LibelulaBreve 1 Pista: ***** Valor pregunta : 23594 Puntos [02:57] LibelulaBreve
1 Pista: ***** Valor pregunta : 23594 Puntos
[02:57] LibelulaBreve 2 Pista: gri** 30 segundos y 23594 Puntos [02:57] LibelulaBreve
2 Pista: gri** 30 segundos y 23594 Puntos
[02:57] LibelulaBreve 3 Pista: gri*o 15 segundos y 23594 Puntos [02:57] LibelulaBreve
3 Pista: gri*o 15 segundos y 23594 Puntos
[02:57] HormigaPedante grifo [02:57] HormigaPedante
grifo
[02:57] Hormiga\Rapaz Éramos fan de la radio antes [02:57] Hormiga\Rapaz
Éramos fan de la radio antes
[02:57] HormigaPedante grino [02:57] HormigaPedante
grino
[02:57] LibelulaBreve Tiempo! La respuesta es -> grito <- [02:57] LibelulaBreve
Tiempo! La respuesta es -> grito <-
[02:58] Gallina_SinRespeto ah ok [02:58] Gallina_SinRespeto
ah ok
[02:58] LibelulaBreve For The Competitive Edge type !pingme [02:58] LibelulaBreve
For The Competitive Edge type !pingme
[02:58] LibelulaBreve Tri.13130 Idiomasɦlipp_er˿ESPAяL--->FRANCES:lunesi?n [02:58] LibelulaBreve
Tri.13130 Idiomasɦlipp_er˿ESPAяL--->FRANCES:lunesi?n
[02:58] LibelulaBreve 1 Pista: ***** Valor pregunta : 17067 Puntos [02:58] LibelulaBreve
1 Pista: ***** Valor pregunta : 17067 Puntos
[02:58] Gallina_SinRespeto y ya no? [02:58] Gallina_SinRespeto
y ya no?
[02:58] Hormiga\Rapaz Ya no [02:58] Hormiga\Rapaz
Ya no
[02:58] Caiman{Sensible no [02:58] Caiman{Sensible
no
[02:58] LibelulaBreve �Muy bien HormigaPedante!! Acertaste "lundi" en tan s󬯠�4.281 segundos y por eso has ganado: �7067�12 puntos [02:58] LibelulaBreve
�Muy bien HormigaPedante!! Acertaste "lundi" en tan s󬯠�4.281 segundos y por eso has ganado: �7067�12 puntos
[02:58] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [02:58] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[02:58] LibelulaBreve HormigaPedante has acertado 4 seguidas!! Puntos HOY: 143444, SEMANA: 143444 y MES: 7369688 [02:58] LibelulaBreve
HormigaPedante has acertado 4 seguidas!! Puntos HOY: 143444, SEMANA: 143444 y MES: 7369688
[02:58] HormigaPedante lundi [02:58] HormigaPedante
lundi
[02:58] Caiman{Sensible no nos kieren [02:58] Caiman{Sensible
no nos kieren
[02:58] LibelulaBreve Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [02:58] LibelulaBreve
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[02:58] LibelulaBreve Tri.13120 Fisica-Quimicaɇallifan˿CUALeESeLAeUNIDADeDEePOTENCIAeLUMINOSAeENeLOSeTUBOSeFLORESCENTESeYeENeLASeBOMBILLASeDEeBAJOeCONSUMOe?e [02:58] LibelulaBreve
Tri.13120 Fisica-Quimicaɇallifan˿CUALeESeLAeUNIDADeDEePOTENCIAeLUMINOSAeENeLOSeTUBOSeFLORESCENTESeYeENeLASeBOMBILLASeDEeBAJOeCONSUMOe?e
[02:58] LibelulaBreve 1 Pista: ***** Valor pregunta : 11828 Puntos [02:58] LibelulaBreve
1 Pista: ***** Valor pregunta : 11828 Puntos
[02:58] Gallina_SinRespeto :O y eso por qué? [02:58] Gallina_SinRespeto
:O y eso por qué?
[02:58] Hormiga\Rapaz XD [02:58] Hormiga\Rapaz
XD
[02:58] Caiman{Sensible ni idea [02:58] Caiman{Sensible
ni idea
[02:58] LibelulaBreve 2 Pista: lum** 30 segundos y 11828 Puntos [02:58] LibelulaBreve
2 Pista: lum** 30 segundos y 11828 Puntos
[02:58] Murcielago}Letal Gallina_SinRespeto: si necesitamos a "Rosie" [02:58] Murcielago}Letal
Gallina_SinRespeto: si necesitamos a "Rosie"
[02:58] Caiman{Sensible se le gasto el fan [02:58] Caiman{Sensible
se le gasto el fan
[02:58] Gallina_SinRespeto piden mucho death metal? 💀😈 [02:58] Gallina_SinRespeto
piden mucho death metal? 💀😈
[02:58] Hormiga\Rapaz Mucho pedia Caiman{Sensible y sin escuchar XD [02:58] Hormiga\Rapaz
Mucho pedia Caiman{Sensible y sin escuchar XD
[02:59] LibelulaBreve 3 Pista: lume* 15 segundos y 11828 Puntos [02:59] LibelulaBreve
3 Pista: lume* 15 segundos y 11828 Puntos
[02:59] Caiman{Sensible [Hormiga\Rapaz] jajajaja [02:59] Caiman{Sensible
[Hormiga\Rapaz] jajajaja
[02:59] HormigaPedante lumis [02:59] HormigaPedante
lumis
[02:59] LibelulaBreve �Est᳠que lo tiras Murcielago}Letal!! ߃󭯠supiste que "lumen" era la respuesta? Venga, �1828�12 puntos suben a tu marcador [02:59] LibelulaBreve
�Est᳠que lo tiras Murcielago}Letal!! ߃󭯠supiste que "lumen" era la respuesta? Venga, �1828�12 puntos suben a tu marcador
[02:59] LibelulaBreve ACTION awards Murcielago}Letal with a +v for having over 15000 points [02:59] LibelulaBreve
ACTION awards Murcielago}Letal with a +v for having over 15000 points
[02:59] LibelulaBreve Murcielago}Letal has acertado 1 seguidas!! Puntos HOY: 47779, SEMANA: 47779 y MES: 117505 [02:59] LibelulaBreve
Murcielago}Letal has acertado 1 seguidas!! Puntos HOY: 47779, SEMANA: 47779 y MES: 117505
[02:59] Murcielago}Letal lumen [02:59] Murcielago}Letal
lumen
[02:59] Jirafa}Fugaz Caiman{Sensible :o [02:59] Jirafa}Fugaz
Caiman{Sensible :o
[02:59] Caiman{Sensible [Hormiga\Rapaz] tu pedias mas [02:59] Caiman{Sensible
[Hormiga\Rapaz] tu pedias mas
[02:59] LibelulaBreve R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7369688 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: Gata_Suave 1043123 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404 [02:59] LibelulaBreve
R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7369688 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: Gata_Suave 1043123 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404
[02:59] LibelulaBreve Tri.20472 Medicina-SaludɍARdeJAVAˌAsPARASCAVEDECATRIAFOBIAsESsELsTEMORsAsUNsD́sQUEsLOSsANGLOSAJONESsHANsCONSIDERADOsTRADICIONALMENTEsDEsMALsFARIO.sߑUɃ01sD́?s?s [02:59] LibelulaBreve
Tri.20472 Medicina-SaludɍARdeJAVAˌAsPARASCAVEDECATRIAFOBIAsESsELsTEMORsAsUNsD́sQUEsLOSsANGLOSAJONESsHANsCONSIDERADOsTRADICIONALMENTEsDEsMALsFARIO.sߑUɃ01sD́?s?s
[02:59] LibelulaBreve 1 Pista: ******* ** Valor pregunta : 16210 Puntos [02:59] LibelulaBreve
1 Pista: ******* ** Valor pregunta : 16210 Puntos
[02:59] Jirafa}Fugaz Murcielago}Letal buenas noches [02:59] Jirafa}Fugaz
Murcielago}Letal buenas noches
[02:59] Caiman{Sensible yo ni escucho [02:59] Caiman{Sensible
yo ni escucho
[02:59] LibelulaBreve 2 Pista: vie**** ** 30 segundos y 16210 Puntos [02:59] LibelulaBreve
2 Pista: vie**** ** 30 segundos y 16210 Puntos
[02:59] Caiman{Sensible [Jirafa}Fugaz] :O [02:59] Caiman{Sensible
[Jirafa}Fugaz] :O
[02:59] Hormiga\Rapaz !dj [02:59] Hormiga\Rapaz
!dj
[02:59] HormigaPedante viernes [02:59] HormigaPedante
viernes
[02:59] Jirafa}Fugaz Caiman{Sensible :o [02:59] Jirafa}Fugaz
Caiman{Sensible :o
[02:59] Aguila}Torpe [Caiman{Sensible] pq el bot de la radio no funciona bien [02:59] Aguila}Torpe
[Caiman{Sensible] pq el bot de la radio no funciona bien
[02:59] LibelulaBreve 3 Pista: vie**e* ** 15 segundos y 16210 Puntos [02:59] LibelulaBreve
3 Pista: vie**e* ** 15 segundos y 16210 Puntos
[03:00] Jirafa}Fugaz Aguila}Torpe buenas noches [03:00] Jirafa}Fugaz
Aguila}Torpe buenas noches
[03:00] LibelulaBreve Tiempo! La respuesta es -> viernes�3 <- [03:00] LibelulaBreve
Tiempo! La respuesta es -> viernes�3 <-
[03:00] HormigaPedante viernes 13 [03:00] HormigaPedante
viernes 13
[03:00] Caiman{Sensible [Aguila}Torpe] ahhh ok ,gracias [03:00] Caiman{Sensible
[Aguila}Torpe] ahhh ok ,gracias
[03:00] LibelulaBreve Please refrain from using Extreme Bad Language [03:00] LibelulaBreve
Please refrain from using Extreme Bad Language
[03:00] LibelulaBreve Tri.10796 Medicina-Saludɴjmm.com˿Elqequivalentepingl鳃01bdepnuestrauUVIqesbla...q?q [03:00] LibelulaBreve
Tri.10796 Medicina-Saludɴjmm.com˿Elqequivalentepingl鳃01bdepnuestrauUVIqesbla...q?q
[03:00] LibelulaBreve 1 Pista: *** Valor pregunta : 17908 Puntos [03:00] LibelulaBreve
1 Pista: *** Valor pregunta : 17908 Puntos
[03:00] Ardilla_Transparente ♪ Sonando: Anillos1 [03:00] Ardilla_Transparente
♪ Sonando: Anillos1
[03:00] Hormiga\Rapaz !tema [03:00] Hormiga\Rapaz
!tema
[03:00] LibelulaBreve 2 Pista: icu 30 segundos y 17908 Puntos [03:00] LibelulaBreve
2 Pista: icu 30 segundos y 17908 Puntos
[03:00] HormigaPedante ucu [03:00] HormigaPedante
ucu
[03:00] Aguila}Torpe [Jirafa}Fugaz] buenas noxes [03:00] Aguila}Torpe
[Jirafa}Fugaz] buenas noxes
[03:00] HormigaPedante icu [03:00] HormigaPedante
icu
[03:00] LibelulaBreve �emuestra lo que sabes HormigaPedante! Has respondido "icu" correctamente y eso te da: �7908�12 puntos [03:00] LibelulaBreve
�emuestra lo que sabes HormigaPedante! Has respondido "icu" correctamente y eso te da: �7908�12 puntos
[03:00] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:00] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:00] LibelulaBreve HormigaPedante has acertado 1 seguidas!! Puntos HOY: 161352, SEMANA: 161352 y MES: 7387596 [03:00] LibelulaBreve
HormigaPedante has acertado 1 seguidas!! Puntos HOY: 161352, SEMANA: 161352 y MES: 7387596
[03:00] Caiman{Sensible yo dije ya no me manda mensajes el bot jajajaja [03:00] Caiman{Sensible
yo dije ya no me manda mensajes el bot jajajaja
[03:00] LibelulaBreve This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve [03:00] LibelulaBreve
This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve
[03:00] LibelulaBreve Tri.772 InformaticaɖaKaMiLKa˿Antescdelb286zquewhab�01o?z [03:00] LibelulaBreve
Tri.772 InformaticaɖaKaMiLKa˿Antescdelb286zquewhab�01o?z
[03:00] LibelulaBreve 1 Pista: **** Valor pregunta : 8652 Puntos [03:00] LibelulaBreve
1 Pista: **** Valor pregunta : 8652 Puntos
[03:01] LibelulaBreve 2 Pista: 808* 30 segundos y 8652 Puntos [03:01] LibelulaBreve
2 Pista: 808* 30 segundos y 8652 Puntos
[03:01] HormigaPedante 8080 [03:01] HormigaPedante
8080
[03:01] LibelulaBreve 3 Pista: 808* 15 segundos y 8652 Puntos [03:01] LibelulaBreve
3 Pista: 808* 15 segundos y 8652 Puntos
[03:01] HormigaPedante 8081 [03:01] HormigaPedante
8081
[03:01] LibelulaBreve Tiempo! La respuesta es -> 8086 <- [03:01] LibelulaBreve
Tiempo! La respuesta es -> 8086 <-
[03:01] LibelulaBreve This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [03:01] LibelulaBreve
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[03:01] LibelulaBreve Tri.2446 Gastronomiaɡnghara˿D󮤥tcomenscodilloyagtodasahorasa?g [03:01] LibelulaBreve
Tri.2446 Gastronomiaɡnghara˿D󮤥tcomenscodilloyagtodasahorasa?g
[03:01] LibelulaBreve 1 Pista: ******** Valor pregunta : 23108 Puntos [03:01] LibelulaBreve
1 Pista: ******** Valor pregunta : 23108 Puntos
[03:02] LibelulaBreve 2 Pista: ale***** 30 segundos y 23108 Puntos [03:02] LibelulaBreve
2 Pista: ale***** 30 segundos y 23108 Puntos
[03:02] LibelulaBreve �Muy bien HormigaPedante!! Acertaste "alemania" en tan s󬯠�2.953 segundos y por eso has ganado: �3108�12 puntos [03:02] LibelulaBreve
�Muy bien HormigaPedante!! Acertaste "alemania" en tan s󬯠�2.953 segundos y por eso has ganado: �3108�12 puntos
[03:02] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:02] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:02] LibelulaBreve HormigaPedante has acertado 2 seguidas!! Puntos HOY: 184460, SEMANA: 184460 y MES: 7410704 [03:02] LibelulaBreve
HormigaPedante has acertado 2 seguidas!! Puntos HOY: 184460, SEMANA: 184460 y MES: 7410704
[03:02] HormigaPedante alemania [03:02] HormigaPedante
alemania
[03:02] LibelulaBreve Please remember this is a FREE service, Please do not complain [03:02] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[03:02] LibelulaBreve Tri.17597 MiscelaneaɐKT_MAN˿Dehqu郰1ucolorpesmlandivisandehunfCabopenfenfEj鲣itopdehTierra?u?u [03:02] LibelulaBreve
Tri.17597 MiscelaneaɐKT_MAN˿Dehqu郰1ucolorpesmlandivisandehunfCabopenfenfEj鲣itopdehTierra?u?u
[03:02] LibelulaBreve 1 Pista: **** Valor pregunta : 19129 Puntos [03:02] LibelulaBreve
1 Pista: **** Valor pregunta : 19129 Puntos
[03:02] LibelulaBreve �Ol頃04HormigaPedante!! Has contestado: "rojo" en �.797 segundos y sumas �9129�12 puntos a tu marcador. �Sigue as� [03:02] LibelulaBreve
�Ol頃04HormigaPedante!! Has contestado: "rojo" en �.797 segundos y sumas �9129�12 puntos a tu marcador. �Sigue as�
[03:02] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:02] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:02] LibelulaBreve HormigaPedante has acertado 3 seguidas!! Puntos HOY: 203589, SEMANA: 203589 y MES: 7429833 [03:02] LibelulaBreve
HormigaPedante has acertado 3 seguidas!! Puntos HOY: 203589, SEMANA: 203589 y MES: 7429833
[03:02] HormigaPedante rojo [03:02] HormigaPedante
rojo
[03:02] LibelulaBreve This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 117505 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065 [03:02] LibelulaBreve
This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 117505 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065
[03:02] LibelulaBreve Tri.2223 MiscelaneaɎAPINE˿FULLER:ELvQUEvNACEvPARAvMORIRvAHORCADO,NUNCAvMORIRA...v?v [03:02] LibelulaBreve
Tri.2223 MiscelaneaɎAPINE˿FULLER:ELvQUEvNACEvPARAvMORIRvAHORCADO,NUNCAvMORIRA...v?v
[03:02] LibelulaBreve 1 Pista: ******* Valor pregunta : 16221 Puntos [03:02] LibelulaBreve
1 Pista: ******* Valor pregunta : 16221 Puntos
[03:02] LibelulaBreve 2 Pista: aho**** 30 segundos y 16221 Puntos [03:02] LibelulaBreve
2 Pista: aho**** 30 segundos y 16221 Puntos
[03:03] LibelulaBreve 3 Pista: aho*a*o 15 segundos y 16221 Puntos [03:03] LibelulaBreve
3 Pista: aho*a*o 15 segundos y 16221 Puntos
[03:03] HormigaPedante ahogado [03:03] HormigaPedante
ahogado
[03:03] LibelulaBreve �Enhorabuena HormigaPedante!! Has contestado "ahogado" y por ello has ganado �6221�12 puntos [03:03] LibelulaBreve
�Enhorabuena HormigaPedante!! Has contestado "ahogado" y por ello has ganado �6221�12 puntos
[03:03] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:03] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:03] LibelulaBreve HormigaPedante has acertado 4 seguidas!! Puntos HOY: 219810, SEMANA: 219810 y MES: 7446054 [03:03] LibelulaBreve
HormigaPedante has acertado 4 seguidas!! Puntos HOY: 219810, SEMANA: 219810 y MES: 7446054
[03:03] Caiman{Sensible [Aguila}Torpe] holaa [03:03] Caiman{Sensible
[Aguila}Torpe] holaa
[03:03] LibelulaBreve R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 [03:03] LibelulaBreve
R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244
[03:03] LibelulaBreve Tri.14481 Medicina-Saludɴamzarian˿Dep󳩴obdexcadᶥresj?h [03:03] LibelulaBreve
Tri.14481 Medicina-Saludɴamzarian˿Dep󳩴obdexcadᶥresj?h
[03:03] LibelulaBreve 1 Pista: ****** Valor pregunta : 5566 Puntos [03:03] LibelulaBreve
1 Pista: ****** Valor pregunta : 5566 Puntos
[03:03] LibelulaBreve 2 Pista: mor*** 30 segundos y 5566 Puntos [03:03] LibelulaBreve
2 Pista: mor*** 30 segundos y 5566 Puntos
[03:03] LibelulaBreve �Increible!! Murcielago}Letal contest󺠃04"morgue" en �5.969 segundos, y ha ganado �566�12 puntos [03:03] LibelulaBreve
�Increible!! Murcielago}Letal contest󺠃04"morgue" en �5.969 segundos, y ha ganado �566�12 puntos
[03:03] LibelulaBreve ACTION awards Murcielago}Letal with a +v for having over 15000 points [03:03] LibelulaBreve
ACTION awards Murcielago}Letal with a +v for having over 15000 points
[03:03] LibelulaBreve Murcielago}Letal has acertado 1 seguidas!! Puntos HOY: 53345, SEMANA: 53345 y MES: 123071 [03:03] LibelulaBreve
Murcielago}Letal has acertado 1 seguidas!! Puntos HOY: 53345, SEMANA: 53345 y MES: 123071
[03:03] Murcielago}Letal morgue [03:03] Murcielago}Letal
morgue
[03:03] HormigaPedante morgen [03:03] HormigaPedante
morgen
[03:03] LibelulaBreve Top10 Players ( Weekly & Monthly ) are Auto-Voiced [03:03] LibelulaBreve
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[03:03] LibelulaBreve Tri.2763 CancionesɓERGISOLO˿Defquienreso"entrefdosoamores"u?u [03:03] LibelulaBreve
Tri.2763 CancionesɓERGISOLO˿Defquienreso"entrefdosoamores"u?u
[03:03] LibelulaBreve 1 Pista: *** ***** Valor pregunta : 5996 Puntos [03:03] LibelulaBreve
1 Pista: *** ***** Valor pregunta : 5996 Puntos
[03:04] LibelulaBreve 2 Pista: ana ***** 30 segundos y 5996 Puntos [03:04] LibelulaBreve
2 Pista: ana ***** 30 segundos y 5996 Puntos
[03:04] LibelulaBreve �e nota que sabes mucho de esto Gata_Suave! Tu respuesta "ana belen" es correcta y ganas �996�12 puntos [03:04] LibelulaBreve
�e nota que sabes mucho de esto Gata_Suave! Tu respuesta "ana belen" es correcta y ganas �996�12 puntos
[03:04] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [03:04] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[03:04] LibelulaBreve Gata_Suave has acertado 1 seguidas!! Puntos HOY: 1049119, SEMANA: 1049119 y MES: 1049119 [03:04] LibelulaBreve
Gata_Suave has acertado 1 seguidas!! Puntos HOY: 1049119, SEMANA: 1049119 y MES: 1049119
[03:04] Gata_Suave ana belen [03:04] Gata_Suave
ana belen
[03:04] LibelulaBreve Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [03:04] LibelulaBreve
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[03:04] LibelulaBreve Tri.9483 Fisica-QuimicaɐiNKiTa˿COMOvSEvDENOMINANvLOSvACIDOSvQUEvHUMEANvENvCONTACTOvCONvELvAIREvHUMEDOv?v [03:04] LibelulaBreve
Tri.9483 Fisica-QuimicaɐiNKiTa˿COMOvSEvDENOMINANvLOSvACIDOSvQUEvHUMEANvENvCONTACTOvCONvELvAIREvHUMEDOv?v
[03:04] LibelulaBreve 1 Pista: ******** Valor pregunta : 11376 Puntos [03:04] LibelulaBreve
1 Pista: ******** Valor pregunta : 11376 Puntos
[03:04] LibelulaBreve 2 Pista: fum***** 30 segundos y 11376 Puntos [03:04] LibelulaBreve
2 Pista: fum***** 30 segundos y 11376 Puntos
[03:04] HormigaPedante fumantes [03:04] HormigaPedante
fumantes
[03:04] LibelulaBreve �Muy bien HormigaPedante!! Acertaste "fumantes" en tan s󬯠�2.094 segundos y por eso has ganado: �1376�12 puntos [03:04] LibelulaBreve
�Muy bien HormigaPedante!! Acertaste "fumantes" en tan s󬯠�2.094 segundos y por eso has ganado: �1376�12 puntos
[03:04] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:04] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:04] LibelulaBreve HormigaPedante has acertado 1 seguidas!! Puntos HOY: 231186, SEMANA: 231186 y MES: 7457430 [03:04] LibelulaBreve
HormigaPedante has acertado 1 seguidas!! Puntos HOY: 231186, SEMANA: 231186 y MES: 7457430
[03:05] LibelulaBreve Tri.9141 Arteɋwahamot˿Engqueeciudadjeuropeaaseeconservaa"LaaPietᢃ01ldeeMiguelvAngel"l?l [03:05] LibelulaBreve
Tri.9141 Arteɋwahamot˿Engqueeciudadjeuropeaaseeconservaa"LaaPietᢃ01ldeeMiguelvAngel"l?l
[03:05] LibelulaBreve 1 Pista: ********* Valor pregunta : 17239 Puntos [03:05] LibelulaBreve
1 Pista: ********* Valor pregunta : 17239 Puntos
[03:05] LibelulaBreve 2 Pista: flo****** 30 segundos y 17239 Puntos [03:05] LibelulaBreve
2 Pista: flo****** 30 segundos y 17239 Puntos
[03:05] HormigaPedante alemania [03:05] HormigaPedante
alemania
[03:05] LibelulaBreve �Enhorabuena Gata_Suave!! Has contestado "florencia" y por ello has ganado �7239�12 puntos [03:05] LibelulaBreve
�Enhorabuena Gata_Suave!! Has contestado "florencia" y por ello has ganado �7239�12 puntos
[03:05] Gata_Suave florencia [03:05] Gata_Suave
florencia
[03:05] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [03:05] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[03:05] LibelulaBreve Gata_Suave has acertado 1 seguidas!! Puntos HOY: 1066358, SEMANA: 1066358 y MES: 1066358 [03:05] LibelulaBreve
Gata_Suave has acertado 1 seguidas!! Puntos HOY: 1066358, SEMANA: 1066358 y MES: 1066358
[03:05] LibelulaBreve We feature over 50,000 Q&A ! [03:05] LibelulaBreve
We feature over 50,000 Q&A !
[03:05] LibelulaBreve Tri.17572 Deporteɂuzzati˿ARGOTxCICLISTA:xCORREDORxCONxFACILIDADxPARAxMOVERSExPORxTERRENOSxLLANOS,xYxCAPAZxDExLLEVARxUNxGRANxDESARROLLOx?x [03:05] LibelulaBreve
Tri.17572 Deporteɂuzzati˿ARGOTxCICLISTA:xCORREDORxCONxFACILIDADxPARAxMOVERSExPORxTERRENOSxLLANOS,xYxCAPAZxDExLLEVARxUNxGRANxDESARROLLOx?x
[03:05] LibelulaBreve 1 Pista: ******* Valor pregunta : 12229 Puntos [03:05] LibelulaBreve
1 Pista: ******* Valor pregunta : 12229 Puntos
[03:05] LibelulaBreve 2 Pista: rod**** 30 segundos y 12229 Puntos [03:05] LibelulaBreve
2 Pista: rod**** 30 segundos y 12229 Puntos
[03:05] HormigaPedante rodado [03:05] HormigaPedante
rodado
[03:06] LibelulaBreve 3 Pista: roda*o* 15 segundos y 12229 Puntos [03:06] LibelulaBreve
3 Pista: roda*o* 15 segundos y 12229 Puntos
[03:06] HormigaPedante rodador [03:06] HormigaPedante
rodador
[03:06] LibelulaBreve �Bien HormigaPedante!! Tu respuesta: "rodador" es correcta y ganas �2229�12 puntos [03:06] LibelulaBreve
�Bien HormigaPedante!! Tu respuesta: "rodador" es correcta y ganas �2229�12 puntos
[03:06] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:06] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:06] LibelulaBreve HormigaPedante has acertado 1 seguidas!! Puntos HOY: 243415, SEMANA: 243415 y MES: 7469659 [03:06] LibelulaBreve
HormigaPedante has acertado 1 seguidas!! Puntos HOY: 243415, SEMANA: 243415 y MES: 7469659
[03:06] LibelulaBreve Tri.6248 HistoriaɎordik˿Hispania:tcapitalqdebbaetica?t?t [03:06] LibelulaBreve
Tri.6248 HistoriaɎordik˿Hispania:tcapitalqdebbaetica?t?t
[03:06] LibelulaBreve 1 Pista: ******* Valor pregunta : 12536 Puntos [03:06] LibelulaBreve
1 Pista: ******* Valor pregunta : 12536 Puntos
[03:06] LibelulaBreve 2 Pista: cor**** 30 segundos y 12536 Puntos [03:06] LibelulaBreve
2 Pista: cor**** 30 segundos y 12536 Puntos
[03:06] LibelulaBreve 3 Pista: cor*u*a 15 segundos y 12536 Puntos [03:06] LibelulaBreve
3 Pista: cor*u*a 15 segundos y 12536 Puntos
[03:06] HormigaPedante coruña [03:06] HormigaPedante
coruña
[03:06] LibelulaBreve Tiempo! La respuesta es -> corduba <- [03:06] LibelulaBreve
Tiempo! La respuesta es -> corduba <-
[03:07] LibelulaBreve Tri.16398 LiteraturaɔeLaRaNhA˿Autorrdel"malamhierba"v?v [03:07] LibelulaBreve
Tri.16398 LiteraturaɔeLaRaNhA˿Autorrdel"malamhierba"v?v
[03:07] LibelulaBreve 1 Pista: *** ****** Valor pregunta : 21342 Puntos [03:07] LibelulaBreve
1 Pista: *** ****** Valor pregunta : 21342 Puntos
[03:07] LibelulaBreve 2 Pista: pio ****** 30 segundos y 21342 Puntos [03:07] LibelulaBreve
2 Pista: pio ****** 30 segundos y 21342 Puntos
[03:07] LibelulaBreve �Increible!! HormigaPedante contest󺠃04"pio baroja" en �9.812 segundos, y ha ganado �1342�12 puntos [03:07] LibelulaBreve
�Increible!! HormigaPedante contest󺠃04"pio baroja" en �9.812 segundos, y ha ganado �1342�12 puntos
[03:07] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:07] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:07] LibelulaBreve HormigaPedante has acertado 2 seguidas!! Puntos HOY: 264757, SEMANA: 264757 y MES: 7491001 [03:07] LibelulaBreve
HormigaPedante has acertado 2 seguidas!! Puntos HOY: 264757, SEMANA: 264757 y MES: 7491001
[03:07] HormigaPedante pio baroja [03:07] HormigaPedante
pio baroja
[03:07] LibelulaBreve Please remember this is a FREE service, Please do not complain [03:07] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[03:07] LibelulaBreve Tri.8620 Medicina-Saludɴjmm.comˁfeccionesminflamatoriasmdevlaxcolumnaxvertebral.l?l [03:07] LibelulaBreve
Tri.8620 Medicina-Saludɴjmm.comˁfeccionesminflamatoriasmdevlaxcolumnaxvertebral.l?l
[03:07] LibelulaBreve 1 Pista: ************ Valor pregunta : 15307 Puntos [03:07] LibelulaBreve
1 Pista: ************ Valor pregunta : 15307 Puntos
[03:07] LibelulaBreve 2 Pista: esp********* 30 segundos y 15307 Puntos [03:07] LibelulaBreve
2 Pista: esp********* 30 segundos y 15307 Puntos
[03:08] LibelulaBreve 3 Pista: espo**i*i*i* 15 segundos y 15307 Puntos [03:08] LibelulaBreve
3 Pista: espo**i*i*i* 15 segundos y 15307 Puntos
[03:08] HormigaPedante espinografia [03:08] HormigaPedante
espinografia
[03:08] LibelulaBreve �Absolutamente correcto HormigaPedante!! Acertaste "espondilitis" en �8.641 segundos y ganas �5307�12 puntos [03:08] LibelulaBreve
�Absolutamente correcto HormigaPedante!! Acertaste "espondilitis" en �8.641 segundos y ganas �5307�12 puntos
[03:08] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:08] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:08] LibelulaBreve HormigaPedante has acertado 3 seguidas!! Puntos HOY: 280064, SEMANA: 280064 y MES: 7506308 [03:08] LibelulaBreve
HormigaPedante has acertado 3 seguidas!! Puntos HOY: 280064, SEMANA: 280064 y MES: 7506308
[03:08] HormigaPedante espondilitis [03:08] HormigaPedante
espondilitis
[03:08] LibelulaBreve R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663 [03:08] LibelulaBreve
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663
[03:08] LibelulaBreve Tri.18130 Eros-SexɄonNadieˌagllamabanbMar�01gMartillooporque...u?u [03:08] LibelulaBreve
Tri.18130 Eros-SexɄonNadieˌagllamabanbMar�01gMartillooporque...u?u
[03:08] LibelulaBreve 1 Pista: ** ** ******* **** Valor pregunta : 12133 Puntos [03:08] LibelulaBreve
1 Pista: ** ** ******* **** Valor pregunta : 12133 Puntos
[03:08] LibelulaBreve 2 Pista: se�* ******* **** 30 segundos y 12133 Puntos [03:08] LibelulaBreve
2 Pista: se�* ******* **** 30 segundos y 12133 Puntos
[03:08] Ardilla_Transparente ✅ Hormiga\Rapaz, su pedido ha sido enviado a karkamal. [03:08] Ardilla_Transparente
✅ Hormiga\Rapaz, su pedido ha sido enviado a karkamal.
[03:08] Hormiga\Rapaz !tocame sweet harmony - the beloved [03:08] Hormiga\Rapaz
!tocame sweet harmony - the beloved
[03:08] LibelulaBreve 3 Pista: se�o **a*a*a *o*o 15 segundos y 12133 Puntos [03:08] LibelulaBreve
3 Pista: se�o **a*a*a *o*o 15 segundos y 12133 Puntos
[03:09] LibelulaBreve Tiempo! La respuesta es -> se�o�lavaba�odo <- [03:09] LibelulaBreve
Tiempo! La respuesta es -> se�o�lavaba�odo <-
[03:09] LibelulaBreve If you think a Q&A is wrong, please call an OP [03:09] LibelulaBreve
If you think a Q&A is wrong, please call an OP
[03:09] LibelulaBreve Tri.4310 DeporteɔeLaRaNhA˿Futbol:sCampeonodefcopahintercontinentaln2003-2004s?s [03:09] LibelulaBreve
Tri.4310 DeporteɔeLaRaNhA˿Futbol:sCampeonodefcopahintercontinentaln2003-2004s?s
[03:09] LibelulaBreve 1 Pista: **** ******* Valor pregunta : 18262 Puntos [03:09] LibelulaBreve
1 Pista: **** ******* Valor pregunta : 18262 Puntos
[03:09] Caiman{Sensible ves estas pidiendo mucho jaja [03:09] Caiman{Sensible
ves estas pidiendo mucho jaja
[03:09] Hormiga\Rapaz XD [03:09] Hormiga\Rapaz
XD
[03:09] LibelulaBreve 2 Pista: boc* ******* 30 segundos y 18262 Puntos [03:09] LibelulaBreve
2 Pista: boc* ******* 30 segundos y 18262 Puntos
[03:09] LibelulaBreve 3 Pista: boca *u*io** 15 segundos y 18262 Puntos [03:09] LibelulaBreve
3 Pista: boca *u*io** 15 segundos y 18262 Puntos
[03:09] HormigaPedante boca junior [03:09] HormigaPedante
boca junior
[03:10] LibelulaBreve �e nota que sabes mucho de esto HormigaPedante! Tu respuesta "boca juniors" es correcta y ganas �8262�12 puntos [03:10] LibelulaBreve
�e nota que sabes mucho de esto HormigaPedante! Tu respuesta "boca juniors" es correcta y ganas �8262�12 puntos
[03:10] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:10] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:10] LibelulaBreve HormigaPedante has acertado 4 seguidas!! Puntos HOY: 298326, SEMANA: 298326 y MES: 7524570 [03:10] LibelulaBreve
HormigaPedante has acertado 4 seguidas!! Puntos HOY: 298326, SEMANA: 298326 y MES: 7524570
[03:10] HormigaPedante boca juniors [03:10] HormigaPedante
boca juniors
[03:10] LibelulaBreve R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708 [03:10] LibelulaBreve
R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708
[03:10] LibelulaBreve Tri.14457 Politicaɤassler˿Enuqu郰1wlocalidadqtuvoblugarcelsencuentrobdexHitlercconuPetain?w?w [03:10] LibelulaBreve
Tri.14457 Politicaɤassler˿Enuqu郰1wlocalidadqtuvoblugarcelsencuentrobdexHitlercconuPetain?w?w
[03:10] LibelulaBreve 1 Pista: ******** *** ** **** Valor pregunta : 23477 Puntos [03:10] LibelulaBreve
1 Pista: ******** *** ** **** Valor pregunta : 23477 Puntos
[03:10] LibelulaBreve 2 Pista: mon***** *** ** **** 30 segundos y 23477 Puntos [03:10] LibelulaBreve
2 Pista: mon***** *** ** **** 30 segundos y 23477 Puntos
[03:10] LibelulaBreve 3 Pista: mon*oi*e *u* *e *oi* 15 segundos y 23477 Puntos [03:10] LibelulaBreve
3 Pista: mon*oi*e *u* *e *oi* 15 segundos y 23477 Puntos
[03:10] LibelulaBreve Tiempo! La respuesta es -> montoire�ur�e�oir <- [03:10] LibelulaBreve
Tiempo! La respuesta es -> montoire�ur�e�oir <-
[03:10] HormigaPedante montoire sur de loir [03:10] HormigaPedante
montoire sur de loir
[03:11] LibelulaBreve For The Competitive Edge type !pingme [03:11] LibelulaBreve
For The Competitive Edge type !pingme
[03:11] LibelulaBreve Tri.7191 Economiaɚytox˿LawmonedawdewKuwaitbessel...b?b [03:11] LibelulaBreve
Tri.7191 Economiaɚytox˿LawmonedawdewKuwaitbessel...b?b
[03:11] LibelulaBreve 1 Pista: ***** Valor pregunta : 18734 Puntos [03:11] LibelulaBreve
1 Pista: ***** Valor pregunta : 18734 Puntos
[03:11] Caiman{Sensible pide un helado mejor [03:11] Caiman{Sensible
pide un helado mejor
[03:11] LibelulaBreve 2 Pista: din** 30 segundos y 18734 Puntos [03:11] LibelulaBreve
2 Pista: din** 30 segundos y 18734 Puntos
[03:11] LibelulaBreve �Increible!! HormigaPedante contest󺠃04"dinAR" en �4.75 segundos, y ha ganado �8734�12 puntos [03:11] LibelulaBreve
�Increible!! HormigaPedante contest󺠃04"dinAR" en �4.75 segundos, y ha ganado �8734�12 puntos
[03:11] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:11] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:11] LibelulaBreve HormigaPedante has acertado 5 seguidas!! Puntos HOY: 317060, SEMANA: 317060 y MES: 7543304 [03:11] LibelulaBreve
HormigaPedante has acertado 5 seguidas!! Puntos HOY: 317060, SEMANA: 317060 y MES: 7543304
[03:11] HormigaPedante dinAR [03:11] HormigaPedante
dinAR
[03:11] LibelulaBreve Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [03:11] LibelulaBreve
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[03:11] LibelulaBreve Tri.19370 Musicaɴjmm.com˿HistoriaxdeloPop:pQu郰1pgrupodinstrumentaloform󃰱pCliffrRichard?p?p [03:11] LibelulaBreve
Tri.19370 Musicaɴjmm.com˿HistoriaxdeloPop:pQu郰1pgrupodinstrumentaloform󃰱pCliffrRichard?p?p
[03:11] LibelulaBreve 1 Pista: *** ******* Valor pregunta : 12635 Puntos [03:11] LibelulaBreve
1 Pista: *** ******* Valor pregunta : 12635 Puntos
[03:11] LibelulaBreve 2 Pista: the ******* 30 segundos y 12635 Puntos [03:11] LibelulaBreve
2 Pista: the ******* 30 segundos y 12635 Puntos
[03:12] LibelulaBreve 3 Pista: the **a*o** 15 segundos y 12635 Puntos [03:12] LibelulaBreve
3 Pista: the **a*o** 15 segundos y 12635 Puntos
[03:12] LibelulaBreve Tiempo! La respuesta es -> the�hadows <- [03:12] LibelulaBreve
Tiempo! La respuesta es -> the�hadows <-
[03:12] Hormiga\Rapaz De que sabor el helado ? [03:12] Hormiga\Rapaz
De que sabor el helado ?
[03:12] LibelulaBreve R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7543304 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: Gata_Suave 1066358 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404 [03:12] LibelulaBreve
R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7543304 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: Gata_Suave 1066358 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404
[03:12] LibelulaBreve Tri.18431 MusicaɓESINO˿BajoydemlosySexaPistols,afallecidoyely3ademfebreroydem1979aaycausaydemunaysobredosisy?a [03:12] LibelulaBreve
Tri.18431 MusicaɓESINO˿BajoydemlosySexaPistols,afallecidoyely3ademfebreroydem1979aaycausaydemunaysobredosisy?a
[03:12] LibelulaBreve 1 Pista: *** ******* Pregunta de BONUS : 25000 Puntos [03:12] LibelulaBreve
1 Pista: *** ******* Pregunta de BONUS : 25000 Puntos
[03:12] LibelulaBreve 2 Pista: sid ******* 30 segundos y 25000 Puntos [03:12] LibelulaBreve
2 Pista: sid ******* 30 segundos y 25000 Puntos
[03:13] LibelulaBreve 3 Pista: sid *i*iou* 15 segundos y 25000 Puntos [03:13] LibelulaBreve
3 Pista: sid *i*iou* 15 segundos y 25000 Puntos
[03:13] LibelulaBreve Tiempo! La respuesta es -> sid�icious <- [03:13] LibelulaBreve
Tiempo! La respuesta es -> sid�icious <-
[03:13] LibelulaBreve Please refrain from using Extreme Bad Language [03:13] LibelulaBreve
Please refrain from using Extreme Bad Language
[03:13] LibelulaBreve Tri.11621 Literaturaɖronski˿Autorkdej"Elylibroidejarenaj?j [03:13] LibelulaBreve
Tri.11621 Literaturaɖronski˿Autorkdej"Elylibroidejarenaj?j
[03:13] LibelulaBreve 1 Pista: ***** **** ****** Valor pregunta : 17243 Puntos [03:13] LibelulaBreve
1 Pista: ***** **** ****** Valor pregunta : 17243 Puntos
[03:13] LibelulaBreve 2 Pista: jor** **** ****** 30 segundos y 17243 Puntos [03:13] LibelulaBreve
2 Pista: jor** **** ****** 30 segundos y 17243 Puntos
[03:13] LibelulaBreve �Suma y sigue HormigaPedante!! La respuesta: "JORGE LUIS BORGES" incrementa tu marcador en �7243�12 puntos [03:13] LibelulaBreve
�Suma y sigue HormigaPedante!! La respuesta: "JORGE LUIS BORGES" incrementa tu marcador en �7243�12 puntos
[03:13] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:13] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:13] LibelulaBreve HormigaPedante has acertado 6 seguidas!! Puntos HOY: 334303, SEMANA: 334303 y MES: 7560547 [03:13] LibelulaBreve
HormigaPedante has acertado 6 seguidas!! Puntos HOY: 334303, SEMANA: 334303 y MES: 7560547
[03:13] HormigaPedante JORGE LUIS BORGES [03:13] HormigaPedante
JORGE LUIS BORGES
[03:13] Zebra-SinLuces Avisando a HormigaPedante de que no use mayúsculas. [1] [03:13] Zebra-SinLuces
Avisando a HormigaPedante de que no use mayúsculas. [1]
[03:14] LibelulaBreve This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve [03:14] LibelulaBreve
This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve
[03:14] LibelulaBreve Tri.15567 Historiaɦrederikːrᣴicawm᳃01hgenuinawdewlawDemocraciawdewlawAtenashClᳩcaw?p [03:14] LibelulaBreve
Tri.15567 Historiaɦrederikːrᣴicawm᳃01hgenuinawdewlawDemocraciawdewlawAtenashClᳩcaw?p
[03:14] LibelulaBreve 1 Pista: ********** Valor pregunta : 23541 Puntos [03:14] LibelulaBreve
1 Pista: ********** Valor pregunta : 23541 Puntos
[03:14] LibelulaBreve 2 Pista: ost******* 30 segundos y 23541 Puntos [03:14] LibelulaBreve
2 Pista: ost******* 30 segundos y 23541 Puntos
[03:14] LibelulaBreve 3 Pista: ost*a*i**o 15 segundos y 23541 Puntos [03:14] LibelulaBreve
3 Pista: ost*a*i**o 15 segundos y 23541 Puntos
[03:14] LibelulaBreve Tiempo! La respuesta es -> ostracismo <- [03:14] LibelulaBreve
Tiempo! La respuesta es -> ostracismo <-
[03:15] LibelulaBreve This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [03:15] LibelulaBreve
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[03:15] LibelulaBreve Tri.17499 Biologiaɂatval˿COMOnSEnLLAMANnLOSnANIMALESnQUEnCOMENnRAICES?n?n [03:15] LibelulaBreve
Tri.17499 Biologiaɂatval˿COMOnSEnLLAMANnLOSnANIMALESnQUEnCOMENnRAICES?n?n
[03:15] LibelulaBreve 1 Pista: ********* Valor pregunta : 8263 Puntos [03:15] LibelulaBreve
1 Pista: ********* Valor pregunta : 8263 Puntos
[03:15] LibelulaBreve 2 Pista: riz****** 30 segundos y 8263 Puntos [03:15] LibelulaBreve
2 Pista: riz****** 30 segundos y 8263 Puntos
[03:15] Caiman{Sensible de fresa [03:15] Caiman{Sensible
de fresa
[03:15] HormigaPedante RIZAFAGOS [03:15] HormigaPedante
RIZAFAGOS
[03:15] LibelulaBreve 3 Pista: rizo*a*o* 15 segundos y 8263 Puntos [03:15] LibelulaBreve
3 Pista: rizo*a*o* 15 segundos y 8263 Puntos
[03:15] LibelulaBreve �Eso es HormigaPedante!! Dijiste: "RIZOFAGOS" y ello te ha valido: �263�12 puntos [03:15] LibelulaBreve
�Eso es HormigaPedante!! Dijiste: "RIZOFAGOS" y ello te ha valido: �263�12 puntos
[03:15] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:15] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:15] LibelulaBreve HormigaPedante has acertado 7 seguidas!! Puntos HOY: 342566, SEMANA: 342566 y MES: 7568810 [03:15] LibelulaBreve
HormigaPedante has acertado 7 seguidas!! Puntos HOY: 342566, SEMANA: 342566 y MES: 7568810
[03:15] HormigaPedante RIZOFAGOS [03:15] HormigaPedante
RIZOFAGOS
[03:15] LibelulaBreve Please remember this is a FREE service, Please do not complain [03:15] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[03:15] LibelulaBreve Tri.15637 Arteɭartuniki˿AUTORlDElLAlESTATUAlDElBRONCElHOMBRElCONlCORDEROl?l [03:15] LibelulaBreve
Tri.15637 Arteɭartuniki˿AUTORlDElLAlESTATUAlDElBRONCElHOMBRElCONlCORDEROl?l
[03:15] LibelulaBreve 1 Pista: ***** ******* Valor pregunta : 15500 Puntos [03:15] LibelulaBreve
1 Pista: ***** ******* Valor pregunta : 15500 Puntos
[03:15] Hormiga\Rapaz Solo fresa ? Mejor mitad fresa y mitad chocolate :p [03:15] Hormiga\Rapaz
Solo fresa ? Mejor mitad fresa y mitad chocolate :p
[03:15] LibelulaBreve 2 Pista: pab** ******* 30 segundos y 15500 Puntos [03:15] LibelulaBreve
2 Pista: pab** ******* 30 segundos y 15500 Puntos
[03:16] LibelulaBreve �Increible!! HormigaPedante contest󺠃04"PABLO PICASSO" en �6.766 segundos, y ha ganado �5500�12 puntos [03:16] LibelulaBreve
�Increible!! HormigaPedante contest󺠃04"PABLO PICASSO" en �6.766 segundos, y ha ganado �5500�12 puntos
[03:16] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:16] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:16] LibelulaBreve HormigaPedante has acertado 8 seguidas!! Puntos HOY: 358066, SEMANA: 358066 y MES: 7584310 [03:16] LibelulaBreve
HormigaPedante has acertado 8 seguidas!! Puntos HOY: 358066, SEMANA: 358066 y MES: 7584310
[03:16] HormigaPedante PABLO PICASSO [03:16] HormigaPedante
PABLO PICASSO
[03:16] Zebra-SinLuces Avisando a HormigaPedante de que no use mayúsculas. [1] [03:16] Zebra-SinLuces
Avisando a HormigaPedante de que no use mayúsculas. [1]
[03:16] LibelulaBreve This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 123071 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065 [03:16] LibelulaBreve
This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 123071 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065
[03:16] LibelulaBreve Tri.7193 HistoriaɍARdeJAVAˈISTORIAjDEjCHINA:jߑUɃ01jSON:jSHANG,jZHOU,jQIN,jHAN,jXIN,jTANGjYjMING?j?j [03:16] LibelulaBreve
Tri.7193 HistoriaɍARdeJAVAˈISTORIAjDEjCHINA:jߑUɃ01jSON:jSHANG,jZHOU,jQIN,jHAN,jXIN,jTANGjYjMING?j?j
[03:16] LibelulaBreve 1 Pista: ********* Valor pregunta : 9338 Puntos [03:16] LibelulaBreve
1 Pista: ********* Valor pregunta : 9338 Puntos
[03:16] LibelulaBreve 2 Pista: din****** 30 segundos y 9338 Puntos [03:16] LibelulaBreve
2 Pista: din****** 30 segundos y 9338 Puntos
[03:16] LibelulaBreve 3 Pista: dina**ia* 15 segundos y 9338 Puntos [03:16] LibelulaBreve
3 Pista: dina**ia* 15 segundos y 9338 Puntos
[03:16] Caiman{Sensible vainilla ,no chocolate [03:16] Caiman{Sensible
vainilla ,no chocolate
[03:16] HormigaPedante DINAMICAS [03:16] HormigaPedante
DINAMICAS
[03:17] Zebra-SinLuces Avisando a HormigaPedante de que no use mayúsculas. [1] [03:17] Zebra-SinLuces
Avisando a HormigaPedante de que no use mayúsculas. [1]
[03:17] HormigaPedante DINAMICIAS [03:17] HormigaPedante
DINAMICIAS
[03:17] LibelulaBreve Tiempo! La respuesta es -> dinastias <- [03:17] LibelulaBreve
Tiempo! La respuesta es -> dinastias <-
[03:17] LibelulaBreve R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 [03:17] LibelulaBreve
R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244
[03:17] LibelulaBreve Tri.15180 DeporteɔDI˿CUANTOSrGOLESrMARCOrRAULrENrSUrPRIMERArTEMPORADArENrELrPRIMERrEQUIPOr?r [03:17] LibelulaBreve
Tri.15180 DeporteɔDI˿CUANTOSrGOLESrMARCOrRAULrENrSUrPRIMERArTEMPORADArENrELrPRIMERrEQUIPOr?r
[03:17] LibelulaBreve 1 Pista: ***** Valor pregunta : 14957 Puntos [03:17] LibelulaBreve
1 Pista: ***** Valor pregunta : 14957 Puntos
[03:17] LibelulaBreve 2 Pista: nue** 30 segundos y 14957 Puntos [03:17] LibelulaBreve
2 Pista: nue** 30 segundos y 14957 Puntos
[03:17] HormigaPedante DIEZ [03:17] HormigaPedante
DIEZ
[03:17] HormigaPedante NUEVE [03:17] HormigaPedante
NUEVE
[03:17] LibelulaBreve �Est᳠que lo tiras HormigaPedante!! ߃󭯠supiste que "NUEVE" era la respuesta? Venga, �4957�12 puntos suben a tu marcador [03:17] LibelulaBreve
�Est᳠que lo tiras HormigaPedante!! ߃󭯠supiste que "NUEVE" era la respuesta? Venga, �4957�12 puntos suben a tu marcador
[03:17] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:17] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:17] LibelulaBreve HormigaPedante has acertado 9 seguidas!! Puntos HOY: 373023, SEMANA: 373023 y MES: 7599267 [03:17] LibelulaBreve
HormigaPedante has acertado 9 seguidas!! Puntos HOY: 373023, SEMANA: 373023 y MES: 7599267
[03:17] LibelulaBreve Top10 Players ( Weekly & Monthly ) are Auto-Voiced [03:17] LibelulaBreve
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[03:17] LibelulaBreve Tri.18736 Miscelaneaɓebosinˎoclochaycpeorvquegelxquegnocquierego�c?c [03:17] LibelulaBreve
Tri.18736 Miscelaneaɓebosinˎoclochaycpeorvquegelxquegnocquierego�c?c
[03:17] LibelulaBreve 1 Pista: ***** Valor pregunta : 18396 Puntos [03:17] LibelulaBreve
1 Pista: ***** Valor pregunta : 18396 Puntos
[03:17] HormigaPedante CIEGO [03:17] HormigaPedante
CIEGO
[03:18] Ardilla_Transparente Bienvenido Danielitto ADMIN de Radio Luna de Miel. [03:18] Ardilla_Transparente
Bienvenido Danielitto ADMIN de Radio Luna de Miel.
[03:18] LibelulaBreve 2 Pista: sor** 30 segundos y 18396 Puntos [03:18] LibelulaBreve
2 Pista: sor** 30 segundos y 18396 Puntos
[03:18] HormigaPedante SORDO [03:18] HormigaPedante
SORDO
[03:18] LibelulaBreve �Suma y sigue HormigaPedante!! La respuesta: "SORDO" incrementa tu marcador en �8396�12 puntos [03:18] LibelulaBreve
�Suma y sigue HormigaPedante!! La respuesta: "SORDO" incrementa tu marcador en �8396�12 puntos
[03:18] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:18] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:18] LibelulaBreve HormigaPedante has acertado 10 seguidas!! Puntos HOY: 391419, SEMANA: 391419 y MES: 7617663 [03:18] LibelulaBreve
HormigaPedante has acertado 10 seguidas!! Puntos HOY: 391419, SEMANA: 391419 y MES: 7617663
[03:18] LibelulaBreve Bonus especial de 50000 Puntos para HormigaPedante por acertar 10 seguidas!!! [03:18] LibelulaBreve
Bonus especial de 50000 Puntos para HormigaPedante por acertar 10 seguidas!!!
[03:18] LibelulaBreve Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [03:18] LibelulaBreve
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[03:18] LibelulaBreve Tri.16308 Geografiaɣarlovigo˿EnrqueeregionrfrancesahseeencuentrahCalais?b?b [03:18] LibelulaBreve
Tri.16308 Geografiaɣarlovigo˿EnrqueeregionrfrancesahseeencuentrahCalais?b?b
[03:18] LibelulaBreve 1 Pista: ******** Valor pregunta : 22109 Puntos [03:18] LibelulaBreve
1 Pista: ******** Valor pregunta : 22109 Puntos
[03:18] LibelulaBreve 2 Pista: pic***** 30 segundos y 22109 Puntos [03:18] LibelulaBreve
2 Pista: pic***** 30 segundos y 22109 Puntos
[03:18] LibelulaBreve 3 Pista: pica**ia 15 segundos y 22109 Puntos [03:18] LibelulaBreve
3 Pista: pica**ia 15 segundos y 22109 Puntos
[03:19] LibelulaBreve Tiempo! La respuesta es -> picardia <- [03:19] LibelulaBreve
Tiempo! La respuesta es -> picardia <-
[03:19] LibelulaBreve Tri.2678 MitologiaɆrigotora˿Diosatjaponesatdeldsoldytlatluz?r?r [03:19] LibelulaBreve
Tri.2678 MitologiaɆrigotora˿Diosatjaponesatdeldsoldytlatluz?r?r
[03:19] LibelulaBreve 1 Pista: ********* Valor pregunta : 12315 Puntos [03:19] LibelulaBreve
1 Pista: ********* Valor pregunta : 12315 Puntos
[03:19] LibelulaBreve 2 Pista: ama****** 30 segundos y 12315 Puntos [03:19] LibelulaBreve
2 Pista: ama****** 30 segundos y 12315 Puntos
[03:19] LibelulaBreve 3 Pista: ama*e*a*u 15 segundos y 12315 Puntos [03:19] LibelulaBreve
3 Pista: ama*e*a*u 15 segundos y 12315 Puntos
[03:19] LibelulaBreve �Increible!! HormigaPedante contest󺠃04"AMATERASU" en �9.797 segundos, y ha ganado �2315�12 puntos [03:19] LibelulaBreve
�Increible!! HormigaPedante contest󺠃04"AMATERASU" en �9.797 segundos, y ha ganado �2315�12 puntos
[03:19] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:19] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:19] LibelulaBreve HormigaPedante has acertado 11 seguidas!! Puntos HOY: 453734, SEMANA: 453734 y MES: 7679978 [03:19] LibelulaBreve
HormigaPedante has acertado 11 seguidas!! Puntos HOY: 453734, SEMANA: 453734 y MES: 7679978
[03:19] HormigaPedante AMATERASU [03:19] HormigaPedante
AMATERASU
[03:20] LibelulaBreve We feature over 50,000 Q&A ! [03:20] LibelulaBreve
We feature over 50,000 Q&A !
[03:20] LibelulaBreve Tri.20829 MiscelaneaɁwelete˿LADREMEsELsPERRO,s?s [03:20] LibelulaBreve
Tri.20829 MiscelaneaɁwelete˿LADREMEsELsPERRO,s?s
[03:20] LibelulaBreve 1 Pista: * ** ** ****** Valor pregunta : 7178 Puntos [03:20] LibelulaBreve
1 Pista: * ** ** ****** Valor pregunta : 7178 Puntos
[03:20] LibelulaBreve 2 Pista: y�* ** ****** 30 segundos y 7178 Puntos [03:20] LibelulaBreve
2 Pista: y�* ** ****** 30 segundos y 7178 Puntos
[03:20] LibelulaBreve 3 Pista: y�o *e *ue**a 15 segundos y 7178 Puntos [03:20] LibelulaBreve
3 Pista: y�o *e *ue**a 15 segundos y 7178 Puntos
[03:20] LibelulaBreve Tiempo! La respuesta es -> y�o�e�uerda <- [03:20] LibelulaBreve
Tiempo! La respuesta es -> y�o�e�uerda <-
[03:21] LibelulaBreve Tri.288 Miscelaneaɓebosin˿Encqu郰1sa񯃰1ypresent󃰱slarcasarFordksugmodeloyT?s?s [03:21] LibelulaBreve
Tri.288 Miscelaneaɓebosin˿Encqu郰1sa񯃰1ypresent󃰱slarcasarFordksugmodeloyT?s?s
[03:21] LibelulaBreve 1 Pista: **** Valor pregunta : 14017 Puntos [03:21] LibelulaBreve
1 Pista: **** Valor pregunta : 14017 Puntos
[03:21] LibelulaBreve 2 Pista: 190* 30 segundos y 14017 Puntos [03:21] LibelulaBreve
2 Pista: 190* 30 segundos y 14017 Puntos
[03:21] HormigaPedante y no se 1908 [03:21] HormigaPedante
y no se 1908
[03:21] LibelulaBreve �Ol頃04HormigaPedante!! Has contestado: "1908" en �4.969 segundos y sumas �4017�12 puntos a tu marcador. �Sigue as� [03:21] LibelulaBreve
�Ol頃04HormigaPedante!! Has contestado: "1908" en �4.969 segundos y sumas �4017�12 puntos a tu marcador. �Sigue as�
[03:21] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:21] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:21] LibelulaBreve HormigaPedante has acertado 12 seguidas!! Puntos HOY: 467751, SEMANA: 467751 y MES: 7693995 [03:21] LibelulaBreve
HormigaPedante has acertado 12 seguidas!! Puntos HOY: 467751, SEMANA: 467751 y MES: 7693995
[03:21] HormigaPedante 1908 [03:21] HormigaPedante
1908
[03:21] LibelulaBreve Tri.10393 Medicina-SaludɁttica˿Comovsesdenominahlahaglutinacionodeslasycelulasysanguineas?c?c [03:21] LibelulaBreve
Tri.10393 Medicina-SaludɁttica˿Comovsesdenominahlahaglutinacionodeslasycelulasysanguineas?c?c
[03:21] LibelulaBreve 1 Pista: **************** Valor pregunta : 22390 Puntos [03:21] LibelulaBreve
1 Pista: **************** Valor pregunta : 22390 Puntos
[03:21] LibelulaBreve 2 Pista: hem************* 30 segundos y 22390 Puntos [03:21] LibelulaBreve
2 Pista: hem************* 30 segundos y 22390 Puntos
[03:22] HormigaPedante hemaglutinacion [03:22] HormigaPedante
hemaglutinacion
[03:22] LibelulaBreve 3 Pista: hemoa**u*i*a*io* 15 segundos y 22390 Puntos [03:22] LibelulaBreve
3 Pista: hemoa**u*i*a*io* 15 segundos y 22390 Puntos
[03:22] HormigaPedante hemaglutinacion [03:22] HormigaPedante
hemaglutinacion
[03:22] LibelulaBreve Tiempo! La respuesta es -> hemoaglutinacion <- [03:22] LibelulaBreve
Tiempo! La respuesta es -> hemoaglutinacion <-
[03:22] HormigaPedante hemaoglutinacion [03:22] HormigaPedante
hemaoglutinacion
[03:22] LibelulaBreve Please remember this is a FREE service, Please do not complain [03:22] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[03:22] LibelulaBreve Tri.17249 Fisica-Quimicaɴoyo˿Cuᬃ01heshlaaabreviaturaadehlashreaccioneshreductorashyxoxidantesh?r [03:22] LibelulaBreve
Tri.17249 Fisica-Quimicaɴoyo˿Cuᬃ01heshlaaabreviaturaadehlashreaccioneshreductorashyxoxidantesh?r
[03:22] LibelulaBreve 1 Pista: ***** Valor pregunta : 21783 Puntos [03:22] LibelulaBreve
1 Pista: ***** Valor pregunta : 21783 Puntos
[03:22] LibelulaBreve 2 Pista: red** 30 segundos y 21783 Puntos [03:22] LibelulaBreve
2 Pista: red** 30 segundos y 21783 Puntos
[03:22] LibelulaBreve �Est᳠que lo tiras HormigaPedante!! ߃󭯠supiste que "redox" era la respuesta? Venga, �1783�12 puntos suben a tu marcador [03:22] LibelulaBreve
�Est᳠que lo tiras HormigaPedante!! ߃󭯠supiste que "redox" era la respuesta? Venga, �1783�12 puntos suben a tu marcador
[03:22] HormigaPedante redox [03:22] HormigaPedante
redox
[03:22] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:22] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:22] LibelulaBreve HormigaPedante has acertado 13 seguidas!! Puntos HOY: 489534, SEMANA: 489534 y MES: 7715778 [03:22] LibelulaBreve
HormigaPedante has acertado 13 seguidas!! Puntos HOY: 489534, SEMANA: 489534 y MES: 7715778
[03:23] LibelulaBreve R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663 [03:23] LibelulaBreve
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663
[03:23] LibelulaBreve Tri.15579 Medicina-SaludɌolob˿Eltmedicofquestratamlasiafeccionesideslamnariz,reltoidofyolamgargantamesielt?r?r [03:23] LibelulaBreve
Tri.15579 Medicina-SaludɌolob˿Eltmedicofquestratamlasiafeccionesideslamnariz,reltoidofyolamgargantamesielt?r?r
[03:23] LibelulaBreve 1 Pista: ******************* Valor pregunta : 21554 Puntos [03:23] LibelulaBreve
1 Pista: ******************* Valor pregunta : 21554 Puntos
[03:23] LibelulaBreve 2 Pista: oto**************** 30 segundos y 21554 Puntos [03:23] LibelulaBreve
2 Pista: oto**************** 30 segundos y 21554 Puntos
[03:23] HormigaPedante otorrinolaringologo [03:23] HormigaPedante
otorrinolaringologo
[03:23] LibelulaBreve �Enhorabuena HormigaPedante!! Has contestado "otorrinolaringologo" y por ello has ganado �1554�12 puntos [03:23] LibelulaBreve
�Enhorabuena HormigaPedante!! Has contestado "otorrinolaringologo" y por ello has ganado �1554�12 puntos
[03:23] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:23] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:23] LibelulaBreve HormigaPedante has acertado 14 seguidas!! Puntos HOY: 511088, SEMANA: 511088 y MES: 7737332 [03:23] LibelulaBreve
HormigaPedante has acertado 14 seguidas!! Puntos HOY: 511088, SEMANA: 511088 y MES: 7737332
[03:23] LibelulaBreve If you think a Q&A is wrong, please call an OP [03:23] LibelulaBreve
If you think a Q&A is wrong, please call an OP
[03:23] LibelulaBreve Tri.3712 Personajesɖivian˿Ennqu郰1cfacetavart�icavdestac󃰱cCarmennAmaya?c?c [03:23] LibelulaBreve
Tri.3712 Personajesɖivian˿Ennqu郰1cfacetavart�icavdestac󃰱cCarmennAmaya?c?c
[03:23] LibelulaBreve 1 Pista: ***** Valor pregunta : 22061 Puntos [03:23] LibelulaBreve
1 Pista: ***** Valor pregunta : 22061 Puntos
[03:23] LibelulaBreve 2 Pista: bai** 30 segundos y 22061 Puntos [03:23] LibelulaBreve
2 Pista: bai** 30 segundos y 22061 Puntos
[03:24] LibelulaBreve �Increible!! HormigaPedante contest󺠃04"baile" en �0.125 segundos, y ha ganado �2061�12 puntos [03:24] LibelulaBreve
�Increible!! HormigaPedante contest󺠃04"baile" en �0.125 segundos, y ha ganado �2061�12 puntos
[03:24] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:24] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:24] LibelulaBreve HormigaPedante has acertado 15 seguidas!! Puntos HOY: 533149, SEMANA: 533149 y MES: 7759393 [03:24] LibelulaBreve
HormigaPedante has acertado 15 seguidas!! Puntos HOY: 533149, SEMANA: 533149 y MES: 7759393
[03:24] HormigaPedante baile [03:24] HormigaPedante
baile
[03:24] LibelulaBreve R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708 [03:24] LibelulaBreve
R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708
[03:24] LibelulaBreve Tri.6232 Idiomasɦlipp_er˿FRANCES--->ESPAяL:coeurt?m [03:24] LibelulaBreve
Tri.6232 Idiomasɦlipp_er˿FRANCES--->ESPAяL:coeurt?m
[03:24] LibelulaBreve 1 Pista: ******* Valor pregunta : 9116 Puntos [03:24] LibelulaBreve
1 Pista: ******* Valor pregunta : 9116 Puntos
[03:24] LibelulaBreve 2 Pista: cor**** 30 segundos y 9116 Puntos [03:24] LibelulaBreve
2 Pista: cor**** 30 segundos y 9116 Puntos
[03:24] HormigaPedante corazon [03:24] HormigaPedante
corazon
[03:24] LibelulaBreve �e nota que sabes mucho de esto HormigaPedante! Tu respuesta "corazon" es correcta y ganas �116�12 puntos [03:24] LibelulaBreve
�e nota que sabes mucho de esto HormigaPedante! Tu respuesta "corazon" es correcta y ganas �116�12 puntos
[03:24] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:24] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:24] LibelulaBreve HormigaPedante has acertado 16 seguidas!! Puntos HOY: 542265, SEMANA: 542265 y MES: 7768509 [03:24] LibelulaBreve
HormigaPedante has acertado 16 seguidas!! Puntos HOY: 542265, SEMANA: 542265 y MES: 7768509
[03:24] LibelulaBreve For The Competitive Edge type !pingme [03:24] LibelulaBreve
For The Competitive Edge type !pingme
[03:24] LibelulaBreve Tri.8600 Cienciaɫnna˿Aeronautica:jMaximaqdistanciaqentreaextradosdeaintradosd?j [03:24] LibelulaBreve
Tri.8600 Cienciaɫnna˿Aeronautica:jMaximaqdistanciaqentreaextradosdeaintradosd?j
[03:24] LibelulaBreve 1 Pista: ******* Pregunta de BONUS : 25000 Puntos [03:24] LibelulaBreve
1 Pista: ******* Pregunta de BONUS : 25000 Puntos
[03:25] LibelulaBreve 2 Pista: esp**** 30 segundos y 25000 Puntos [03:25] LibelulaBreve
2 Pista: esp**** 30 segundos y 25000 Puntos
[03:25] HormigaPedante español [03:25] HormigaPedante
español
[03:25] LibelulaBreve 3 Pista: espe*o* 15 segundos y 25000 Puntos [03:25] LibelulaBreve
3 Pista: espe*o* 15 segundos y 25000 Puntos
[03:25] LibelulaBreve �Bingo!! HormigaPedante dio la respuesta: "espesor" en �0.39 segundos e incrementa sus ganancias con �5000�12 puntos [03:25] LibelulaBreve
�Bingo!! HormigaPedante dio la respuesta: "espesor" en �0.39 segundos e incrementa sus ganancias con �5000�12 puntos
[03:25] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:25] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:25] LibelulaBreve HormigaPedante has acertado 17 seguidas!! Puntos HOY: 567265, SEMANA: 567265 y MES: 7793509 [03:25] LibelulaBreve
HormigaPedante has acertado 17 seguidas!! Puntos HOY: 567265, SEMANA: 567265 y MES: 7793509
[03:25] HormigaPedante espesor [03:25] HormigaPedante
espesor
[03:25] LibelulaBreve Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [03:25] LibelulaBreve
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[03:25] LibelulaBreve Tri.20899 DeporteɔDI˿ANTEmQUEmSELECCIONmDEBUTOmJUANITOmCOMOmINTERNACIONALm?m [03:25] LibelulaBreve
Tri.20899 DeporteɔDI˿ANTEmQUEmSELECCIONmDEBUTOmJUANITOmCOMOmINTERNACIONALm?m
[03:25] LibelulaBreve 1 Pista: ********** Valor pregunta : 23524 Puntos [03:25] LibelulaBreve
1 Pista: ********** Valor pregunta : 23524 Puntos
[03:25] LibelulaBreve 2 Pista: yug******* 30 segundos y 23524 Puntos [03:25] LibelulaBreve
2 Pista: yug******* 30 segundos y 23524 Puntos
[03:26] HormigaPedante guslabia [03:26] HormigaPedante
guslabia
[03:26] HormigaPedante yugoslava [03:26] HormigaPedante
yugoslava
[03:26] LibelulaBreve 3 Pista: yugo**a*ia 15 segundos y 23524 Puntos [03:26] LibelulaBreve
3 Pista: yugo**a*ia 15 segundos y 23524 Puntos
[03:26] LibelulaBreve �emuestra lo que sabes HormigaPedante! Has respondido "yugoslavia" correctamente y eso te da: �3524�12 puntos [03:26] LibelulaBreve
�emuestra lo que sabes HormigaPedante! Has respondido "yugoslavia" correctamente y eso te da: �3524�12 puntos
[03:26] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:26] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:26] LibelulaBreve HormigaPedante has acertado 18 seguidas!! Puntos HOY: 590789, SEMANA: 590789 y MES: 7817033 [03:26] LibelulaBreve
HormigaPedante has acertado 18 seguidas!! Puntos HOY: 590789, SEMANA: 590789 y MES: 7817033
[03:26] HormigaPedante yugoslavia [03:26] HormigaPedante
yugoslavia
[03:26] LibelulaBreve R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7793509 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: Gata_Suave 1066358 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404 [03:26] LibelulaBreve
R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7793509 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: Gata_Suave 1066358 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404
[03:26] LibelulaBreve Tri.14925 Geografiaɓebosin˿Decqu郰1qr�01esonosusadosabrazosam᳃01aimportantesaelcDamiettahyielcRosetta?q?q [03:26] LibelulaBreve
Tri.14925 Geografiaɓebosin˿Decqu郰1qr�01esonosusadosabrazosam᳃01aimportantesaelcDamiettahyielcRosetta?q?q
[03:26] LibelulaBreve 1 Pista: **** Valor pregunta : 7821 Puntos [03:26] LibelulaBreve
1 Pista: **** Valor pregunta : 7821 Puntos
[03:26] LibelulaBreve �Gata_Suave acert󡡠La respuesta era: "nilo" y contest󠥮 �.031 segundos. Se lleva: �821�12 puntos [03:26] LibelulaBreve
�Gata_Suave acert󡡠La respuesta era: "nilo" y contest󠥮 �.031 segundos. Se lleva: �821�12 puntos
[03:26] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [03:26] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[03:26] LibelulaBreve Gata_Suave has acertado 1 seguidas!! Puntos HOY: 1074179, SEMANA: 1074179 y MES: 1074179 [03:26] LibelulaBreve
Gata_Suave has acertado 1 seguidas!! Puntos HOY: 1074179, SEMANA: 1074179 y MES: 1074179
[03:26] Gata_Suave nilo [03:26] Gata_Suave
nilo
[03:26] LibelulaBreve Please refrain from using Extreme Bad Language [03:26] LibelulaBreve
Please refrain from using Extreme Bad Language
[03:26] LibelulaBreve Tri.17901 GeografiaɍARdeJAVA˿CU�rESrLArCIUDADrM�rGRANDErDELrESTADOrDErUTAH?r?r [03:26] LibelulaBreve
Tri.17901 GeografiaɍARdeJAVA˿CU�rESrLArCIUDADrM�rGRANDErDELrESTADOrDErUTAH?r?r
[03:26] LibelulaBreve 1 Pista: **** **** **** Valor pregunta : 17114 Puntos [03:26] LibelulaBreve
1 Pista: **** **** **** Valor pregunta : 17114 Puntos
[03:26] HormigaPedante Gata_Suave  volviste gracias a dios [03:26] HormigaPedante
Gata_Suave  volviste gracias a dios
[03:27] LibelulaBreve 2 Pista: sal* **** **** 30 segundos y 17114 Puntos [03:27] LibelulaBreve
2 Pista: sal* **** **** 30 segundos y 17114 Puntos
[03:27] Gata_Suave hola HormigaPedante [03:27] Gata_Suave
hola HormigaPedante
[03:27] LibelulaBreve �Suma y sigue Gata_Suave!! La respuesta: "salt lake city" incrementa tu marcador en �7114�12 puntos [03:27] LibelulaBreve
�Suma y sigue Gata_Suave!! La respuesta: "salt lake city" incrementa tu marcador en �7114�12 puntos
[03:27] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [03:27] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[03:27] LibelulaBreve Gata_Suave has acertado 2 seguidas!! Puntos HOY: 1091293, SEMANA: 1091293 y MES: 1091293 [03:27] LibelulaBreve
Gata_Suave has acertado 2 seguidas!! Puntos HOY: 1091293, SEMANA: 1091293 y MES: 1091293
[03:27] Gata_Suave salt lake city [03:27] Gata_Suave
salt lake city
[03:27] LibelulaBreve This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve [03:27] LibelulaBreve
This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve
[03:27] LibelulaBreve Tri.304 Fisica-Quimicaɖronski˿Enpqueea񯃰1ifueenombradoiPauligtitularideelapcᴥdrapdeef�capte󲩣apenpZurichj?f [03:27] LibelulaBreve
Tri.304 Fisica-Quimicaɖronski˿Enpqueea񯃰1ifueenombradoiPauligtitularideelapcᴥdrapdeef�capte󲩣apenpZurichj?f
[03:27] LibelulaBreve 1 Pista: **** Valor pregunta : 9536 Puntos [03:27] LibelulaBreve
1 Pista: **** Valor pregunta : 9536 Puntos
[03:27] LibelulaBreve 2 Pista: 192* 30 segundos y 9536 Puntos [03:27] LibelulaBreve
2 Pista: 192* 30 segundos y 9536 Puntos
[03:27] HormigaPedante 1928 [03:27] HormigaPedante
1928
[03:27] LibelulaBreve �Increible!! HormigaPedante contest󺠃04"1928" en �3.235 segundos, y ha ganado �536�12 puntos [03:27] LibelulaBreve
�Increible!! HormigaPedante contest󺠃04"1928" en �3.235 segundos, y ha ganado �536�12 puntos
[03:27] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:27] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:27] LibelulaBreve HormigaPedante has acertado 1 seguidas!! Puntos HOY: 600325, SEMANA: 600325 y MES: 7826569 [03:27] LibelulaBreve
HormigaPedante has acertado 1 seguidas!! Puntos HOY: 600325, SEMANA: 600325 y MES: 7826569
[03:28] LibelulaBreve This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [03:28] LibelulaBreve
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[03:28] LibelulaBreve Tri.15992 CancionesɃheewakka˿Dewquienxesq"ThewWayhI'mhFeelingcTonight"t?t [03:28] LibelulaBreve
Tri.15992 CancionesɃheewakka˿Dewquienxesq"ThewWayhI'mhFeelingcTonight"t?t
[03:28] LibelulaBreve 1 Pista: **** ******* Valor pregunta : 8573 Puntos [03:28] LibelulaBreve
1 Pista: **** ******* Valor pregunta : 8573 Puntos
[03:28] LibelulaBreve 2 Pista: pau* ******* 30 segundos y 8573 Puntos [03:28] LibelulaBreve
2 Pista: pau* ******* 30 segundos y 8573 Puntos
[03:28] LibelulaBreve 3 Pista: pau* *a**a** 15 segundos y 8573 Puntos [03:28] LibelulaBreve
3 Pista: pau* *a**a** 15 segundos y 8573 Puntos
[03:28] LibelulaBreve Tiempo! La respuesta es -> paul�arrack <- [03:28] LibelulaBreve
Tiempo! La respuesta es -> paul�arrack <-
[03:28] LibelulaBreve Please remember this is a FREE service, Please do not complain [03:28] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[03:28] LibelulaBreve Tri.3835 HistoriaɆilipides˿ComorsezapodabavelmasndezlavaviacionkalemanavManfredevonkRichthofenk?m [03:28] LibelulaBreve
Tri.3835 HistoriaɆilipides˿ComorsezapodabavelmasndezlavaviacionkalemanavManfredevonkRichthofenk?m
[03:28] LibelulaBreve 1 Pista: ***** **** Valor pregunta : 9344 Puntos [03:28] LibelulaBreve
1 Pista: ***** **** Valor pregunta : 9344 Puntos
[03:29] LibelulaBreve 2 Pista: bar** **** 30 segundos y 9344 Puntos [03:29] LibelulaBreve
2 Pista: bar** **** 30 segundos y 9344 Puntos
[03:29] LibelulaBreve �Ol頃04HormigaPedante!! Has contestado: "baron rojo" en �1.328 segundos y sumas �344�12 puntos a tu marcador. �Sigue as� [03:29] LibelulaBreve
�Ol頃04HormigaPedante!! Has contestado: "baron rojo" en �1.328 segundos y sumas �344�12 puntos a tu marcador. �Sigue as�
[03:29] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:29] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:29] LibelulaBreve HormigaPedante has acertado 2 seguidas!! Puntos HOY: 609669, SEMANA: 609669 y MES: 7835913 [03:29] LibelulaBreve
HormigaPedante has acertado 2 seguidas!! Puntos HOY: 609669, SEMANA: 609669 y MES: 7835913
[03:29] HormigaPedante baron rojo [03:29] HormigaPedante
baron rojo
[03:29] LibelulaBreve This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 123071 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065 [03:29] LibelulaBreve
This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 123071 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065
[03:29] LibelulaBreve Tri.3222 Cotilleo-TVɣarlovigo˿AbquecpuebloxsecfueronoahvivirzAntonioxDavidryiRociitoxdespuesxdecsukboda?b?b [03:29] LibelulaBreve
Tri.3222 Cotilleo-TVɣarlovigo˿AbquecpuebloxsecfueronoahvivirzAntonioxDavidryiRociitoxdespuesxdecsukboda?b?b
[03:29] LibelulaBreve 1 Pista: ********* Valor pregunta : 8932 Puntos [03:29] LibelulaBreve
1 Pista: ********* Valor pregunta : 8932 Puntos
[03:29] LibelulaBreve 2 Pista: arg****** 30 segundos y 8932 Puntos [03:29] LibelulaBreve
2 Pista: arg****** 30 segundos y 8932 Puntos
[03:29] Gata_Suave argentina [03:29] Gata_Suave
argentina
[03:29] HormigaPedante argentina [03:29] HormigaPedante
argentina
[03:29] Gata_Suave pueblo [03:29] Gata_Suave
pueblo
[03:29] LibelulaBreve 3 Pista: arge**o*a 15 segundos y 8932 Puntos [03:29] LibelulaBreve
3 Pista: arge**o*a 15 segundos y 8932 Puntos
[03:30] LibelulaBreve Tiempo! La respuesta es -> argentona <- [03:30] LibelulaBreve
Tiempo! La respuesta es -> argentona <-
[03:30] LibelulaBreve R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 [03:30] LibelulaBreve
R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244
[03:30] LibelulaBreve Tri.1911 CienciaɍARdeJAVA˔ABLEROeOeCUADROeCONeALAMBRESeOeSURCOSePARALELOSeENTREeS̓01eENeLOSeQUEeSEeMUEVENeBOLASeOeCUENTAS,eUTILIZADOeANTIGUAMENTEePARAeREALIZAReC�CULOSeARITMɔICOS.e?e [03:30] LibelulaBreve
Tri.1911 CienciaɍARdeJAVA˔ABLEROeOeCUADROeCONeALAMBRESeOeSURCOSePARALELOSeENTREeS̓01eENeLOSeQUEeSEeMUEVENeBOLASeOeCUENTAS,eUTILIZADOeANTIGUAMENTEePARAeREALIZAReC�CULOSeARITMɔICOS.e?e
[03:30] LibelulaBreve 1 Pista: ***** Pregunta de BONUS : 50000 Puntos [03:30] LibelulaBreve
1 Pista: ***** Pregunta de BONUS : 50000 Puntos
[03:30] LibelulaBreve 2 Pista: aba** 30 segundos y 50000 Puntos [03:30] LibelulaBreve
2 Pista: aba** 30 segundos y 50000 Puntos
[03:30] HormigaPedante abaco [03:30] HormigaPedante
abaco
[03:30] LibelulaBreve �Absolutamente correcto HormigaPedante!! Acertaste "abaco" en �3.141 segundos y ganas �0000�12 puntos [03:30] LibelulaBreve
�Absolutamente correcto HormigaPedante!! Acertaste "abaco" en �3.141 segundos y ganas �0000�12 puntos
[03:30] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:30] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:30] LibelulaBreve HormigaPedante has acertado 3 seguidas!! Puntos HOY: 659669, SEMANA: 659669 y MES: 7885913 [03:30] LibelulaBreve
HormigaPedante has acertado 3 seguidas!! Puntos HOY: 659669, SEMANA: 659669 y MES: 7885913
[03:30] LibelulaBreve Top10 Players ( Weekly & Monthly ) are Auto-Voiced [03:30] LibelulaBreve
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[03:30] LibelulaBreve Tri.15623 GastronomiaɍARdeJAVA˿CU�vESvUNOvDEvLOSvPLATOSvM�vT͐ICOSvYvBARATOSvDEvCATALUс?(ENvCATAL�)v?v [03:30] LibelulaBreve
Tri.15623 GastronomiaɍARdeJAVA˿CU�vESvUNOvDEvLOSvPLATOSvM�vT͐ICOSvYvBARATOSvDEvCATALUс?(ENvCATAL�)v?v
[03:30] LibelulaBreve 1 Pista: ** *** ******** Pregunta de BONUS : 50000 Puntos [03:30] LibelulaBreve
1 Pista: ** *** ******** Pregunta de BONUS : 50000 Puntos
[03:31] LibelulaBreve 2 Pista: pa�** ******** 30 segundos y 50000 Puntos [03:31] LibelulaBreve
2 Pista: pa�** ******** 30 segundos y 50000 Puntos
[03:31] LibelulaBreve 3 Pista: pa�** *o*a*ue* 15 segundos y 50000 Puntos [03:31] LibelulaBreve
3 Pista: pa�** *o*a*ue* 15 segundos y 50000 Puntos
[03:31] LibelulaBreve Tiempo! La respuesta es -> pa�mb�omaquet <- [03:31] LibelulaBreve
Tiempo! La respuesta es -> pa�mb�omaquet <-
[03:31] LibelulaBreve Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [03:31] LibelulaBreve
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[03:31] LibelulaBreve Tri.7623 Fisica-QuimicaɈdosO˿Comogdenominamospallalrepetici󮃰1mdewunmsonidogdebidogallalreflexi󮃰1mdewlaspondaspsonorasp?a [03:31] LibelulaBreve
Tri.7623 Fisica-QuimicaɈdosO˿Comogdenominamospallalrepetici󮃰1mdewunmsonidogdebidogallalreflexi󮃰1mdewlaspondaspsonorasp?a
[03:31] LibelulaBreve 1 Pista: *** Valor pregunta : 10450 Puntos [03:31] LibelulaBreve
1 Pista: *** Valor pregunta : 10450 Puntos
[03:32] LibelulaBreve 2 Pista: eco 30 segundos y 10450 Puntos [03:32] LibelulaBreve
2 Pista: eco 30 segundos y 10450 Puntos
[03:32] LibelulaBreve �Increible!! Gata_Suave contest󺠃04"eco" en �6.86 segundos, y ha ganado �0450�12 puntos [03:32] LibelulaBreve
�Increible!! Gata_Suave contest󺠃04"eco" en �6.86 segundos, y ha ganado �0450�12 puntos
[03:32] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [03:32] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[03:32] LibelulaBreve Gata_Suave has acertado 1 seguidas!! Puntos HOY: 1101743, SEMANA: 1101743 y MES: 1101743 [03:32] LibelulaBreve
Gata_Suave has acertado 1 seguidas!! Puntos HOY: 1101743, SEMANA: 1101743 y MES: 1101743
[03:32] Gata_Suave eco [03:32] Gata_Suave
eco
[03:32] Hormiga\Rapaz !tocame feel good - Michael Buble [03:32] Hormiga\Rapaz
!tocame feel good - Michael Buble
[03:32] Ardilla_Transparente ✅ Hormiga\Rapaz, su pedido ha sido enviado a karkamal. [03:32] Ardilla_Transparente
✅ Hormiga\Rapaz, su pedido ha sido enviado a karkamal.
[03:32] LibelulaBreve Tri.1309 InformaticaɌucky_LuK˿COMOtSEtLLAMAtELtNUEVOtEQUIPOtDEtAPPLEt(a񯃰1v2000)t?t [03:32] LibelulaBreve
Tri.1309 InformaticaɌucky_LuK˿COMOtSEtLLAMAtELtNUEVOtEQUIPOtDEtAPPLEt(a񯃰1v2000)t?t
[03:32] LibelulaBreve 1 Pista: **** Valor pregunta : 19823 Puntos [03:32] LibelulaBreve
1 Pista: **** Valor pregunta : 19823 Puntos
[03:32] LibelulaBreve 2 Pista: IMA* 30 segundos y 19823 Puntos [03:32] LibelulaBreve
2 Pista: IMA* 30 segundos y 19823 Puntos
[03:32] HormigaPedante emac [03:32] HormigaPedante
emac
[03:32] HormigaPedante iman [03:32] HormigaPedante
iman
[03:32] LibelulaBreve 3 Pista: IMA* 15 segundos y 19823 Puntos [03:32] LibelulaBreve
3 Pista: IMA* 15 segundos y 19823 Puntos
[03:32] HormigaPedante imag [03:32] HormigaPedante
imag
[03:32] HormigaPedante imat [03:32] HormigaPedante
imat
[03:32] Gata_Suave imac [03:32] Gata_Suave
imac
[03:32] LibelulaBreve �Suma y sigue Gata_Suave!! La respuesta: "imac" incrementa tu marcador en �9823�12 puntos [03:32] LibelulaBreve
�Suma y sigue Gata_Suave!! La respuesta: "imac" incrementa tu marcador en �9823�12 puntos
[03:32] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [03:32] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[03:32] LibelulaBreve Gata_Suave has acertado 2 seguidas!! Puntos HOY: 1121566, SEMANA: 1121566 y MES: 1121566 [03:32] LibelulaBreve
Gata_Suave has acertado 2 seguidas!! Puntos HOY: 1121566, SEMANA: 1121566 y MES: 1121566
[03:33] LibelulaBreve We feature over 50,000 Q&A ! [03:33] LibelulaBreve
We feature over 50,000 Q&A !
[03:33] LibelulaBreve Tri.18039 Cotilleo-TVɃarPEnTer˿Cuᬃ01reraeelrapellidoodeiRanmae?l [03:33] LibelulaBreve
Tri.18039 Cotilleo-TVɃarPEnTer˿Cuᬃ01reraeelrapellidoodeiRanmae?l
[03:33] LibelulaBreve 1 Pista: ******* Valor pregunta : 14204 Puntos [03:33] LibelulaBreve
1 Pista: ******* Valor pregunta : 14204 Puntos
[03:33] LibelulaBreve 2 Pista: sao**** 30 segundos y 14204 Puntos [03:33] LibelulaBreve
2 Pista: sao**** 30 segundos y 14204 Puntos
[03:33] LibelulaBreve �Bien HormigaPedante!! Tu respuesta: "saotome" es correcta y ganas �4204�12 puntos [03:33] LibelulaBreve
�Bien HormigaPedante!! Tu respuesta: "saotome" es correcta y ganas �4204�12 puntos
[03:33] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:33] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:33] LibelulaBreve HormigaPedante has acertado 1 seguidas!! Puntos HOY: 673873, SEMANA: 673873 y MES: 7900117 [03:33] LibelulaBreve
HormigaPedante has acertado 1 seguidas!! Puntos HOY: 673873, SEMANA: 673873 y MES: 7900117
[03:33] HormigaPedante saotome [03:33] HormigaPedante
saotome
[03:33] LibelulaBreve Tri.20316 MiscelaneaɄUBLINERS˿IlhMoroqdigVeneziaaeswuns...........l?l [03:33] LibelulaBreve
Tri.20316 MiscelaneaɄUBLINERS˿IlhMoroqdigVeneziaaeswuns...........l?l
[03:33] LibelulaBreve 1 Pista: ****** Valor pregunta : 11222 Puntos [03:33] LibelulaBreve
1 Pista: ****** Valor pregunta : 11222 Puntos
[03:33] LibelulaBreve 2 Pista: vel*** 30 segundos y 11222 Puntos [03:33] LibelulaBreve
2 Pista: vel*** 30 segundos y 11222 Puntos
[03:34] LibelulaBreve 3 Pista: vele*o 15 segundos y 11222 Puntos [03:34] LibelulaBreve
3 Pista: vele*o 15 segundos y 11222 Puntos
[03:34] HormigaPedante veleto [03:34] HormigaPedante
veleto
[03:34] HormigaPedante veleco [03:34] HormigaPedante
veleco
[03:34] LibelulaBreve Tiempo! La respuesta es -> velero <- [03:34] LibelulaBreve
Tiempo! La respuesta es -> velero <-
[03:34] LibelulaBreve Tri.12526 Historiaɳubmarin˿LaldivisionjdecquecgeneralhfueclalprimeralenjentraroenjParispenjlalsegundalguerralmundial?d?d [03:34] LibelulaBreve
Tri.12526 Historiaɳubmarin˿LaldivisionjdecquecgeneralhfueclalprimeralenjentraroenjParispenjlalsegundalguerralmundial?d?d
[03:34] LibelulaBreve 1 Pista: ******* Valor pregunta : 17006 Puntos [03:34] LibelulaBreve
1 Pista: ******* Valor pregunta : 17006 Puntos
[03:34] LibelulaBreve 2 Pista: lec**** 30 segundos y 17006 Puntos [03:34] LibelulaBreve
2 Pista: lec**** 30 segundos y 17006 Puntos
[03:35] LibelulaBreve 3 Pista: lec*e** 15 segundos y 17006 Puntos [03:35] LibelulaBreve
3 Pista: lec*e** 15 segundos y 17006 Puntos
[03:35] LibelulaBreve Tiempo! La respuesta es -> leclerc <- [03:35] LibelulaBreve
Tiempo! La respuesta es -> leclerc <-
[03:35] LibelulaBreve Please remember this is a FREE service, Please do not complain [03:35] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[03:35] LibelulaBreve Tri.9067 InformaticaɉRC-Domain˿HErramientaspderaccesibilidad:sajustaulaurespuestaudelvtecladoi?s [03:35] LibelulaBreve
Tri.9067 InformaticaɉRC-Domain˿HErramientaspderaccesibilidad:sajustaulaurespuestaudelvtecladoi?s
[03:35] LibelulaBreve 1 Pista: ********** Valor pregunta : 8162 Puntos [03:35] LibelulaBreve
1 Pista: ********** Valor pregunta : 8162 Puntos
[03:35] LibelulaBreve 2 Pista: fil******* 30 segundos y 8162 Puntos [03:35] LibelulaBreve
2 Pista: fil******* 30 segundos y 8162 Puntos
[03:36] LibelulaBreve 3 Pista: fil*e**e** 15 segundos y 8162 Puntos [03:36] LibelulaBreve
3 Pista: fil*e**e** 15 segundos y 8162 Puntos
[03:36] LibelulaBreve Tiempo! La respuesta es -> filterkeys <- [03:36] LibelulaBreve
Tiempo! La respuesta es -> filterkeys <-
[03:36] LibelulaBreve R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663 [03:36] LibelulaBreve
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663
[03:36] LibelulaBreve Tri.5200 LiteraturaɔeLaRaNhA˿Diccionario:xSinonimosdetcasta񵥬au?x [03:36] LibelulaBreve
Tri.5200 LiteraturaɔeLaRaNhA˿Diccionario:xSinonimosdetcasta񵥬au?x
[03:36] LibelulaBreve 1 Pista: *****񪪪 Valor pregunta : 22135 Puntos [03:36] LibelulaBreve
1 Pista: *****񪪪 Valor pregunta : 22135 Puntos
[03:36] LibelulaBreve 2 Pista: cas**񪪪 30 segundos y 22135 Puntos [03:36] LibelulaBreve
2 Pista: cas**񪪪 30 segundos y 22135 Puntos
[03:36] LibelulaBreve 3 Pista: cas*a񥪡 15 segundos y 22135 Puntos [03:36] LibelulaBreve
3 Pista: cas*a񥪡 15 segundos y 22135 Puntos
[03:37] HormigaPedante castañuela [03:37] HormigaPedante
castañuela
[03:37] LibelulaBreve Tiempo! La respuesta es -> casta񥴡 <- [03:37] LibelulaBreve
Tiempo! La respuesta es -> casta񥴡 <-
[03:37] LibelulaBreve If you think a Q&A is wrong, please call an OP [03:37] LibelulaBreve
If you think a Q&A is wrong, please call an OP
[03:37] LibelulaBreve Tri.11906 Geografiaɳorgo˿Enhqu郰1nEstadosNorteamericanossebencuentrajlajciudadxdebWICHITA?n?n [03:37] LibelulaBreve
Tri.11906 Geografiaɳorgo˿Enhqu郰1nEstadosNorteamericanossebencuentrajlajciudadxdebWICHITA?n?n
[03:37] LibelulaBreve 1 Pista: ****** Valor pregunta : 12577 Puntos [03:37] LibelulaBreve
1 Pista: ****** Valor pregunta : 12577 Puntos
[03:37] LibelulaBreve 2 Pista: kan*** 30 segundos y 12577 Puntos [03:37] LibelulaBreve
2 Pista: kan*** 30 segundos y 12577 Puntos
[03:37] LibelulaBreve �Muy bien HormigaPedante!! Acertaste "kansas" en tan s󬯠�9.125 segundos y por eso has ganado: �2577�12 puntos [03:37] LibelulaBreve
�Muy bien HormigaPedante!! Acertaste "kansas" en tan s󬯠�9.125 segundos y por eso has ganado: �2577�12 puntos
[03:37] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:37] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:37] LibelulaBreve HormigaPedante has acertado 2 seguidas!! Puntos HOY: 686450, SEMANA: 686450 y MES: 7912694 [03:37] LibelulaBreve
HormigaPedante has acertado 2 seguidas!! Puntos HOY: 686450, SEMANA: 686450 y MES: 7912694
[03:37] HormigaPedante kansas [03:37] HormigaPedante
kansas
[03:38] LibelulaBreve R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708 [03:38] LibelulaBreve
R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708
[03:38] LibelulaBreve Tri.18713 Cotilleo-TVɋNNA˿(DIBUJOS)߃OMOmSEmLLAMAmELmMEJORmAMIGOmQUEmTIENEmBULMAmQUEmLOmCONOCEmDESDEmQUEmERAmPEQUE񉔏?m?m [03:38] LibelulaBreve
Tri.18713 Cotilleo-TVɋNNA˿(DIBUJOS)߃OMOmSEmLLAMAmELmMEJORmAMIGOmQUEmTIENEmBULMAmQUEmLOmCONOCEmDESDEmQUEmERAmPEQUE񉔏?m?m
[03:38] LibelulaBreve 1 Pista: *** **** Valor pregunta : 15055 Puntos [03:38] LibelulaBreve
1 Pista: *** **** Valor pregunta : 15055 Puntos
[03:38] LibelulaBreve 2 Pista: son **** 30 segundos y 15055 Puntos [03:38] LibelulaBreve
2 Pista: son **** 30 segundos y 15055 Puntos
[03:38] LibelulaBreve 3 Pista: son *o*u 15 segundos y 15055 Puntos [03:38] LibelulaBreve
3 Pista: son *o*u 15 segundos y 15055 Puntos
[03:38] HormigaPedante +son goku [03:38] HormigaPedante
+son goku
[03:38] LibelulaBreve Tiempo! La respuesta es -> son�oku <- [03:38] LibelulaBreve
Tiempo! La respuesta es -> son�oku <-
[03:38] HormigaPedante son goku [03:38] HormigaPedante
son goku
[03:38] LibelulaBreve For The Competitive Edge type !pingme [03:38] LibelulaBreve
For The Competitive Edge type !pingme
[03:38] LibelulaBreve Tri.19929 BiologiaɓkNdALoSu˿Cuallesielldinosauriodmitificadodporhserhellmasipeligrosodcarnivorodqueghakhabitadodellplanetak?d [03:38] LibelulaBreve
Tri.19929 BiologiaɓkNdALoSu˿Cuallesielldinosauriodmitificadodporhserhellmasipeligrosodcarnivorodqueghakhabitadodellplanetak?d
[03:38] LibelulaBreve 1 Pista: ************* *** Valor pregunta : 15470 Puntos [03:38] LibelulaBreve
1 Pista: ************* *** Valor pregunta : 15470 Puntos
[03:39] LibelulaBreve 2 Pista: tyr********** *** 30 segundos y 15470 Puntos [03:39] LibelulaBreve
2 Pista: tyr********** *** 30 segundos y 15470 Puntos
[03:39] LibelulaBreve 3 Pista: tyra**o*au*u* *e* 15 segundos y 15470 Puntos [03:39] LibelulaBreve
3 Pista: tyra**o*au*u* *e* 15 segundos y 15470 Puntos
[03:39] HormigaPedante tyranosaurio [03:39] HormigaPedante
tyranosaurio
[03:39] LibelulaBreve Tiempo! La respuesta es -> tyrannosaurus�ex <- [03:39] LibelulaBreve
Tiempo! La respuesta es -> tyrannosaurus�ex <-
[03:39] LibelulaBreve Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [03:39] LibelulaBreve
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[03:39] LibelulaBreve Tri.2665 Eros-Sexɖonda˿Enfqu郰1d�nicarpel�lardepsumcarrera,ddirigidarporpVicentepAranda,dapareci󃰱ddesnudozcompletamentepelxactorpJorgepSanzd?d [03:39] LibelulaBreve
Tri.2665 Eros-Sexɖonda˿Enfqu郰1d�nicarpel�lardepsumcarrera,ddirigidarporpVicentepAranda,dapareci󃰱ddesnudozcompletamentepelxactorpJorgepSanzd?d
[03:39] LibelulaBreve 1 Pista: ******* Valor pregunta : 18277 Puntos [03:39] LibelulaBreve
1 Pista: ******* Valor pregunta : 18277 Puntos
[03:40] LibelulaBreve 2 Pista: ama**** 30 segundos y 18277 Puntos [03:40] LibelulaBreve
2 Pista: ama**** 30 segundos y 18277 Puntos
[03:40] HormigaPedante amantes [03:40] HormigaPedante
amantes
[03:40] LibelulaBreve �Increible!! HormigaPedante contest󺠃04"amantes" en �1.344 segundos, y ha ganado �8277�12 puntos [03:40] LibelulaBreve
�Increible!! HormigaPedante contest󺠃04"amantes" en �1.344 segundos, y ha ganado �8277�12 puntos
[03:40] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:40] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:40] LibelulaBreve HormigaPedante has acertado 3 seguidas!! Puntos HOY: 704727, SEMANA: 704727 y MES: 7930971 [03:40] LibelulaBreve
HormigaPedante has acertado 3 seguidas!! Puntos HOY: 704727, SEMANA: 704727 y MES: 7930971
[03:40] LibelulaBreve R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7912694 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: Gata_Suave 1121566 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404 [03:40] LibelulaBreve
R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7912694 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2340304 #8: Gata_Suave 1121566 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404
[03:40] LibelulaBreve Tri.13653 Gastronomiaɍonteso˿Demquempaisiesioriginariogelecuscusi?c [03:40] LibelulaBreve
Tri.13653 Gastronomiaɍonteso˿Demquempaisiesioriginariogelecuscusi?c
[03:40] LibelulaBreve 1 Pista: ********* Valor pregunta : 13086 Puntos [03:40] LibelulaBreve
1 Pista: ********* Valor pregunta : 13086 Puntos
[03:40] LibelulaBreve 2 Pista: mar****** 30 segundos y 13086 Puntos [03:40] LibelulaBreve
2 Pista: mar****** 30 segundos y 13086 Puntos
[03:40] LibelulaBreve �emuestra lo que sabes Gata_Suave! Has respondido "marruecos" correctamente y eso te da: �3086�12 puntos [03:40] LibelulaBreve
�emuestra lo que sabes Gata_Suave! Has respondido "marruecos" correctamente y eso te da: �3086�12 puntos
[03:40] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [03:40] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[03:40] LibelulaBreve Gata_Suave has acertado 1 seguidas!! Puntos HOY: 1134652, SEMANA: 1134652 y MES: 1134652 [03:40] LibelulaBreve
Gata_Suave has acertado 1 seguidas!! Puntos HOY: 1134652, SEMANA: 1134652 y MES: 1134652
[03:40] Gata_Suave marruecos [03:40] Gata_Suave
marruecos
[03:40] HormigaPedante marruecos [03:40] HormigaPedante
marruecos
[03:40] LibelulaBreve Please refrain from using Extreme Bad Language [03:40] LibelulaBreve
Please refrain from using Extreme Bad Language
[03:40] LibelulaBreve Tri.2161 Cienciaɴjmm.comˍinerallcompuestojporfcapaskdemcuarzojdemvarioskcolores.b?b [03:40] LibelulaBreve
Tri.2161 Cienciaɴjmm.comˍinerallcompuestojporfcapaskdemcuarzojdemvarioskcolores.b?b
[03:40] LibelulaBreve 1 Pista: ***** Valor pregunta : 24407 Puntos [03:40] LibelulaBreve
1 Pista: ***** Valor pregunta : 24407 Puntos
[03:41] HormigaPedante onis [03:41] HormigaPedante
onis
[03:41] LibelulaBreve 2 Pista: aga** 30 segundos y 24407 Puntos [03:41] LibelulaBreve
2 Pista: aga** 30 segundos y 24407 Puntos
[03:41] HormigaPedante agata [03:41] HormigaPedante
agata
[03:41] LibelulaBreve �Muy bien HormigaPedante!! Acertaste "agata" en tan s󬯠�0.312 segundos y por eso has ganado: �4407�12 puntos [03:41] LibelulaBreve
�Muy bien HormigaPedante!! Acertaste "agata" en tan s󬯠�0.312 segundos y por eso has ganado: �4407�12 puntos
[03:41] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:41] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:41] LibelulaBreve HormigaPedante has acertado 1 seguidas!! Puntos HOY: 729134, SEMANA: 729134 y MES: 7955378 [03:41] LibelulaBreve
HormigaPedante has acertado 1 seguidas!! Puntos HOY: 729134, SEMANA: 729134 y MES: 7955378
[03:41] LibelulaBreve This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve [03:41] LibelulaBreve
This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve
[03:41] LibelulaBreve Tri.15417 Biologiaɂatval˿COMOnSEnLLAMANnLOSnANIMALESnQUEnCOMENnU񁓿n?n [03:41] LibelulaBreve
Tri.15417 Biologiaɂatval˿COMOnSEnLLAMANnLOSnANIMALESnQUEnCOMENnU񁓿n?n
[03:41] LibelulaBreve 1 Pista: ********** Valor pregunta : 16645 Puntos [03:41] LibelulaBreve
1 Pista: ********** Valor pregunta : 16645 Puntos
[03:41] Gata_Suave you know how i feel [03:41] Gata_Suave
you know how i feel
[03:41] HormigaPedante frugivoros [03:41] HormigaPedante
frugivoros
[03:41] LibelulaBreve 2 Pista: oni******* 30 segundos y 16645 Puntos [03:41] LibelulaBreve
2 Pista: oni******* 30 segundos y 16645 Puntos
[03:41] HormigaPedante oonivoros [03:41] HormigaPedante
oonivoros
[03:41] LibelulaBreve 3 Pista: oni*o*a*o* 15 segundos y 16645 Puntos [03:41] LibelulaBreve
3 Pista: oni*o*a*o* 15 segundos y 16645 Puntos
[03:42] LibelulaBreve Tiempo! La respuesta es -> onicofagos <- [03:42] LibelulaBreve
Tiempo! La respuesta es -> onicofagos <-
[03:42] LibelulaBreve This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [03:42] LibelulaBreve
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[03:42] LibelulaBreve Tri.4910 GastronomiaɌuik˿DEhQUEhCOMUNDADhAUTONOMAhEShLAhDENOMINACIONhDEhORIGENh"VALLEhDEhLAhOROTAVA"h?h [03:42] LibelulaBreve
Tri.4910 GastronomiaɌuik˿DEhQUEhCOMUNDADhAUTONOMAhEShLAhDENOMINACIONhDEhORIGENh"VALLEhDEhLAhOROTAVA"h?h
[03:42] LibelulaBreve 1 Pista: ******** Valor pregunta : 24982 Puntos [03:42] LibelulaBreve
1 Pista: ******** Valor pregunta : 24982 Puntos
[03:42] LibelulaBreve 2 Pista: can***** 30 segundos y 24982 Puntos [03:42] LibelulaBreve
2 Pista: can***** 30 segundos y 24982 Puntos
[03:42] HormigaPedante ocanaria [03:42] HormigaPedante
ocanaria
[03:42] LibelulaBreve �Increible!! HormigaPedante contest󺠃04"canarias" en �9.875 segundos, y ha ganado �4982�12 puntos [03:42] LibelulaBreve
�Increible!! HormigaPedante contest󺠃04"canarias" en �9.875 segundos, y ha ganado �4982�12 puntos
[03:42] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:42] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:42] LibelulaBreve HormigaPedante has acertado 2 seguidas!! Puntos HOY: 754116, SEMANA: 754116 y MES: 7980360 [03:42] LibelulaBreve
HormigaPedante has acertado 2 seguidas!! Puntos HOY: 754116, SEMANA: 754116 y MES: 7980360
[03:42] HormigaPedante canarias [03:42] HormigaPedante
canarias
[03:43] LibelulaBreve Please remember this is a FREE service, Please do not complain [03:43] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[03:43] LibelulaBreve Tri.6463 InformaticaɉRC-Domain˿Extensionndemloskarchivoskdemtextovennloskquemloskcamposkestᮃ01nseparadoskporicomas.b?b [03:43] LibelulaBreve
Tri.6463 InformaticaɉRC-Domain˿Extensionndemloskarchivoskdemtextovennloskquemloskcamposkestᮃ01nseparadoskporicomas.b?b
[03:43] LibelulaBreve 1 Pista: *** Valor pregunta : 22786 Puntos [03:43] LibelulaBreve
1 Pista: *** Valor pregunta : 22786 Puntos
[03:43] LibelulaBreve 2 Pista: csv 30 segundos y 22786 Puntos [03:43] LibelulaBreve
2 Pista: csv 30 segundos y 22786 Puntos
[03:43] HormigaPedante csv [03:43] HormigaPedante
csv
[03:43] LibelulaBreve �As�e hace HormigaPedante!! Contestaste "csv" en �2.484 segundos y sumas �2786�12 puntos [03:43] LibelulaBreve
�As�e hace HormigaPedante!! Contestaste "csv" en �2.484 segundos y sumas �2786�12 puntos
[03:43] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:43] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:43] LibelulaBreve HormigaPedante has acertado 3 seguidas!! Puntos HOY: 776902, SEMANA: 776902 y MES: 8003146 [03:43] LibelulaBreve
HormigaPedante has acertado 3 seguidas!! Puntos HOY: 776902, SEMANA: 776902 y MES: 8003146
[03:43] LibelulaBreve This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 123071 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065 [03:43] LibelulaBreve
This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 123071 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065
[03:43] LibelulaBreve Tri.10111 Cancionesɔadeus˿GRUPObAUTORbDEbOPENbYOURbEYESb?b [03:43] LibelulaBreve
Tri.10111 Cancionesɔadeus˿GRUPObAUTORbDEbOPENbYOURbEYESb?b
[03:43] LibelulaBreve 1 Pista: ***** **** Valor pregunta : 10864 Puntos [03:43] LibelulaBreve
1 Pista: ***** **** Valor pregunta : 10864 Puntos
[03:43] LibelulaBreve 2 Pista: gua** **** 30 segundos y 10864 Puntos [03:43] LibelulaBreve
2 Pista: gua** **** 30 segundos y 10864 Puntos
[03:43] HormigaPedante snow patrol [03:43] HormigaPedante
snow patrol
[03:44] LibelulaBreve 3 Pista: gua*o a*e* 15 segundos y 10864 Puntos [03:44] LibelulaBreve
3 Pista: gua*o a*e* 15 segundos y 10864 Puntos
[03:44] LibelulaBreve Tiempo! La respuesta es -> guano�pes <- [03:44] LibelulaBreve
Tiempo! La respuesta es -> guano�pes <-
[03:44] LibelulaBreve R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 [03:44] LibelulaBreve
R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244
[03:44] LibelulaBreve Tri.18930 Idiomasɦlipp_er˿ESPAяL--->INGLES:domingoy?o [03:44] LibelulaBreve
Tri.18930 Idiomasɦlipp_er˿ESPAяL--->INGLES:domingoy?o
[03:44] LibelulaBreve 1 Pista: ****** Valor pregunta : 15407 Puntos [03:44] LibelulaBreve
1 Pista: ****** Valor pregunta : 15407 Puntos
[03:44] LibelulaBreve �Suma y sigue HormigaPedante!! La respuesta: "sunday" incrementa tu marcador en �5407�12 puntos [03:44] LibelulaBreve
�Suma y sigue HormigaPedante!! La respuesta: "sunday" incrementa tu marcador en �5407�12 puntos
[03:44] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:44] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:44] LibelulaBreve HormigaPedante has acertado 4 seguidas!! Puntos HOY: 792309, SEMANA: 792309 y MES: 8018553 [03:44] LibelulaBreve
HormigaPedante has acertado 4 seguidas!! Puntos HOY: 792309, SEMANA: 792309 y MES: 8018553
[03:44] HormigaPedante sunday [03:44] HormigaPedante
sunday
[03:44] LibelulaBreve Top10 Players ( Weekly & Monthly ) are Auto-Voiced [03:44] LibelulaBreve
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[03:44] LibelulaBreve Tri.20543 Miscelaneaɓebosin˿(Religi󮩑ui鮥sjcomponenwlasTrimurtiwenwelshinduismo?u?u [03:44] LibelulaBreve
Tri.20543 Miscelaneaɓebosin˿(Religi󮩑ui鮥sjcomponenwlasTrimurtiwenwelshinduismo?u?u
[03:44] LibelulaBreve 1 Pista: ***** **** * ****** Valor pregunta : 18000 Puntos [03:44] LibelulaBreve
1 Pista: ***** **** * ****** Valor pregunta : 18000 Puntos
[03:45] LibelulaBreve 2 Pista: vis** **** * ****** 30 segundos y 18000 Puntos [03:45] LibelulaBreve
2 Pista: vis** **** * ****** 30 segundos y 18000 Puntos
[03:45] LibelulaBreve 3 Pista: vis*u *i*a * **a**a 15 segundos y 18000 Puntos [03:45] LibelulaBreve
3 Pista: vis*u *i*a * **a**a 15 segundos y 18000 Puntos
[03:45] Gata_Suave shiva [03:45] Gata_Suave
shiva
[03:45] Gata_Suave vistu [03:45] Gata_Suave
vistu
[03:45] LibelulaBreve Tiempo! La respuesta es -> visnu�iva��rahma <- [03:45] LibelulaBreve
Tiempo! La respuesta es -> visnu�iva��rahma <-
[03:45] LibelulaBreve Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [03:45] LibelulaBreve
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[03:45] LibelulaBreve Tri.5660 MitologiaɄivah˿DIOSAsASIaTICAsDsELAsFERTILDADsCONsMORADAsENsLAsCIUDADsDEsPESINOSs?s [03:45] LibelulaBreve
Tri.5660 MitologiaɄivah˿DIOSAsASIaTICAsDsELAsFERTILDADsCONsMORADAsENsLAsCIUDADsDEsPESINOSs?s
[03:45] LibelulaBreve 1 Pista: ******* Valor pregunta : 15362 Puntos [03:45] LibelulaBreve
1 Pista: ******* Valor pregunta : 15362 Puntos
[03:46] LibelulaBreve 2 Pista: cib**** 30 segundos y 15362 Puntos [03:46] LibelulaBreve
2 Pista: cib**** 30 segundos y 15362 Puntos
[03:46] HormigaPedante fertility [03:46] HormigaPedante
fertility
[03:46] LibelulaBreve 3 Pista: cibe*e* 15 segundos y 15362 Puntos [03:46] LibelulaBreve
3 Pista: cibe*e* 15 segundos y 15362 Puntos
[03:46] LibelulaBreve �Est᳠que lo tiras Gata_Suave!! ߃󭯠supiste que "cibeles" era la respuesta? Venga, �5362�12 puntos suben a tu marcador [03:46] LibelulaBreve
�Est᳠que lo tiras Gata_Suave!! ߃󭯠supiste que "cibeles" era la respuesta? Venga, �5362�12 puntos suben a tu marcador
[03:46] LibelulaBreve ACTION awards Gata_Suave with a +v for having over 15000 points [03:46] LibelulaBreve
ACTION awards Gata_Suave with a +v for having over 15000 points
[03:46] LibelulaBreve Gata_Suave has acertado 1 seguidas!! Puntos HOY: 1150014, SEMANA: 1150014 y MES: 1150014 [03:46] LibelulaBreve
Gata_Suave has acertado 1 seguidas!! Puntos HOY: 1150014, SEMANA: 1150014 y MES: 1150014
[03:46] Gata_Suave cibeles [03:46] Gata_Suave
cibeles
[03:46] LibelulaBreve Tri.382 Musicaɰailas˿Enyqueca񯃰1mmuri󃰱sDukecEllingtony?s [03:46] LibelulaBreve
Tri.382 Musicaɰailas˿Enyqueca񯃰1mmuri󃰱sDukecEllingtony?s
[03:46] LibelulaBreve 1 Pista: **** Valor pregunta : 5333 Puntos [03:46] LibelulaBreve
1 Pista: **** Valor pregunta : 5333 Puntos
[03:46] HormigaPedante 2021 [03:46] HormigaPedante
2021
[03:46] LibelulaBreve 2 Pista: 197* 30 segundos y 5333 Puntos [03:46] LibelulaBreve
2 Pista: 197* 30 segundos y 5333 Puntos
[03:47] LibelulaBreve 3 Pista: 197* 15 segundos y 5333 Puntos [03:47] LibelulaBreve
3 Pista: 197* 15 segundos y 5333 Puntos
[03:47] HormigaPedante 1977 [03:47] HormigaPedante
1977
[03:47] LibelulaBreve Tiempo! La respuesta es -> 1974 <- [03:47] LibelulaBreve
Tiempo! La respuesta es -> 1974 <-
[03:47] LibelulaBreve We feature over 50,000 Q&A ! [03:47] LibelulaBreve
We feature over 50,000 Q&A !
[03:47] LibelulaBreve Tri.18821 Deporteɣarlovigo˿F.CxBarcelona-Jugadorxescocesidellosi80x?x [03:47] LibelulaBreve
Tri.18821 Deporteɣarlovigo˿F.CxBarcelona-Jugadorxescocesidellosi80x?x
[03:47] LibelulaBreve 1 Pista: ***** ********* Valor pregunta : 10723 Puntos [03:47] LibelulaBreve
1 Pista: ***** ********* Valor pregunta : 10723 Puntos
[03:47] LibelulaBreve 2 Pista: ste** ********* 30 segundos y 10723 Puntos [03:47] LibelulaBreve
2 Pista: ste** ********* 30 segundos y 10723 Puntos
[03:47] LibelulaBreve 3 Pista: ste*e a***i*a** 15 segundos y 10723 Puntos [03:47] LibelulaBreve
3 Pista: ste*e a***i*a** 15 segundos y 10723 Puntos
[03:48] LibelulaBreve Tiempo! La respuesta es -> steve�rchibald <- [03:48] LibelulaBreve
Tiempo! La respuesta es -> steve�rchibald <-
[03:48] LibelulaBreve Tri.2668 Idiomasɳorgo˿CHINO-ESPAяL:cHUANG?c?c [03:48] LibelulaBreve
Tri.2668 Idiomasɳorgo˿CHINO-ESPAяL:cHUANG?c?c
[03:48] LibelulaBreve 1 Pista: ******** Valor pregunta : 17152 Puntos [03:48] LibelulaBreve
1 Pista: ******** Valor pregunta : 17152 Puntos
[03:48] LibelulaBreve 2 Pista: ama***** 30 segundos y 17152 Puntos [03:48] LibelulaBreve
2 Pista: ama***** 30 segundos y 17152 Puntos
[03:48] HormigaPedante schuster amarillo [03:48] HormigaPedante
schuster amarillo
[03:48] LibelulaBreve 3 Pista: ama*i**o 15 segundos y 17152 Puntos [03:48] LibelulaBreve
3 Pista: ama*i**o 15 segundos y 17152 Puntos
[03:49] HormigaPedante amarillo [03:49] HormigaPedante
amarillo
[03:49] LibelulaBreve �Increible!! HormigaPedante contest󺠃04"amarillo" en �8.734 segundos, y ha ganado �7152�12 puntos [03:49] LibelulaBreve
�Increible!! HormigaPedante contest󺠃04"amarillo" en �8.734 segundos, y ha ganado �7152�12 puntos
[03:49] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:49] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:49] LibelulaBreve HormigaPedante has acertado 1 seguidas!! Puntos HOY: 809461, SEMANA: 809461 y MES: 8035705 [03:49] LibelulaBreve
HormigaPedante has acertado 1 seguidas!! Puntos HOY: 809461, SEMANA: 809461 y MES: 8035705
[03:49] LibelulaBreve Tri.18729 GastronomiaɁnghara˿EnkFranciafmezclankcebolla,ecaldokderave,emantequilla,eaceite,equesoketcpyftienen...e?e [03:49] LibelulaBreve
Tri.18729 GastronomiaɁnghara˿EnkFranciafmezclankcebolla,ecaldokderave,emantequilla,eaceite,equesoketcpyftienen...e?e
[03:49] LibelulaBreve 1 Pista: **** ** ******* Valor pregunta : 6881 Puntos [03:49] LibelulaBreve
1 Pista: **** ** ******* Valor pregunta : 6881 Puntos
[03:49] LibelulaBreve 2 Pista: sop* ** ******* 30 segundos y 6881 Puntos [03:49] LibelulaBreve
2 Pista: sop* ** ******* 30 segundos y 6881 Puntos
[03:49] LibelulaBreve 3 Pista: sopa *e *e*o**a 15 segundos y 6881 Puntos [03:49] LibelulaBreve
3 Pista: sopa *e *e*o**a 15 segundos y 6881 Puntos
[03:49] HormigaPedante sopa de verduras [03:49] HormigaPedante
sopa de verduras
[03:49] Aguila}Torpe sopa de cebolla [03:49] Aguila}Torpe
sopa de cebolla
[03:49] LibelulaBreve �Eso es Aguila}Torpe!! Dijiste: "sopa de cebolla" y ello te ha valido: �881�12 puntos [03:49] LibelulaBreve
�Eso es Aguila}Torpe!! Dijiste: "sopa de cebolla" y ello te ha valido: �881�12 puntos
[03:49] LibelulaBreve Aguila}Torpe has acertado 1 seguidas!! Puntos HOY: 6881, SEMANA: 6881 y MES: 2347185 [03:49] LibelulaBreve
Aguila}Torpe has acertado 1 seguidas!! Puntos HOY: 6881, SEMANA: 6881 y MES: 2347185
[03:50] LibelulaBreve Please remember this is a FREE service, Please do not complain [03:50] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[03:50] LibelulaBreve Tri.2347 ArteɐEDROC˿DIRECTORpDELpGRUPOpDEpTEATROp"ELSpJOGLARS"p?p?p [03:50] LibelulaBreve
Tri.2347 ArteɐEDROC˿DIRECTORpDELpGRUPOpDEpTEATROp"ELSpJOGLARS"p?p?p
[03:50] LibelulaBreve 1 Pista: ****** ******** Valor pregunta : 21354 Puntos [03:50] LibelulaBreve
1 Pista: ****** ******** Valor pregunta : 21354 Puntos
[03:50] LibelulaBreve 2 Pista: alb*** ******** 30 segundos y 21354 Puntos [03:50] LibelulaBreve
2 Pista: alb*** ******** 30 segundos y 21354 Puntos
[03:50] HormigaPedante ramon fontsere [03:50] HormigaPedante
ramon fontsere
[03:50] LibelulaBreve 3 Pista: albe** *oa*e**a 15 segundos y 21354 Puntos [03:50] LibelulaBreve
3 Pista: albe** *oa*e**a 15 segundos y 21354 Puntos
[03:50] LibelulaBreve Tiempo! La respuesta es -> albert�oadella <- [03:50] LibelulaBreve
Tiempo! La respuesta es -> albert�oadella <-
[03:50] Aguila}Torpe albert boadella [03:50] Aguila}Torpe
albert boadella
[03:51] LibelulaBreve R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663 [03:51] LibelulaBreve
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663
[03:51] LibelulaBreve Tri.7640 PersonajesɅME^˿ENfQUɃ01fLOCALIDADfNACIӃ01fELfPINTORfESPAяLfFERNANDOfBRIONES?f?f [03:51] LibelulaBreve
Tri.7640 PersonajesɅME^˿ENfQUɃ01fLOCALIDADfNACIӃ01fELfPINTORfESPAяLfFERNANDOfBRIONES?f?f
[03:51] LibelulaBreve 1 Pista: ***** Valor pregunta : 21807 Puntos [03:51] LibelulaBreve
1 Pista: ***** Valor pregunta : 21807 Puntos
[03:51] LibelulaBreve 2 Pista: eci** 30 segundos y 21807 Puntos [03:51] LibelulaBreve
2 Pista: eci** 30 segundos y 21807 Puntos
[03:51] LibelulaBreve �Muy bien Aguila}Torpe!! Acertaste "ecija" en tan s󬯠�9.844 segundos y por eso has ganado: �1807�12 puntos [03:51] LibelulaBreve
�Muy bien Aguila}Torpe!! Acertaste "ecija" en tan s󬯠�9.844 segundos y por eso has ganado: �1807�12 puntos
[03:51] LibelulaBreve Aguila}Torpe has acertado 2 seguidas!! Puntos HOY: 28688, SEMANA: 28688 y MES: 2368992 [03:51] LibelulaBreve
Aguila}Torpe has acertado 2 seguidas!! Puntos HOY: 28688, SEMANA: 28688 y MES: 2368992
[03:51] Aguila}Torpe ecija [03:51] Aguila}Torpe
ecija
[03:51] LibelulaBreve If you think a Q&A is wrong, please call an OP [03:51] LibelulaBreve
If you think a Q&A is wrong, please call an OP
[03:51] LibelulaBreve Tri.6739 Cotilleo-TVɅME^˿CONyQUɃ01yCANTANTEyBRIT�ICOyEST�01yCASADAyLAyMODELOySOMAL̓01yIM�y?y?y [03:51] LibelulaBreve
Tri.6739 Cotilleo-TVɅME^˿CONyQUɃ01yCANTANTEyBRIT�ICOyEST�01yCASADAyLAyMODELOySOMAL̓01yIM�y?y?y
[03:51] LibelulaBreve 1 Pista: ***** ***** Valor pregunta : 6636 Puntos [03:51] LibelulaBreve
1 Pista: ***** ***** Valor pregunta : 6636 Puntos
[03:51] LibelulaBreve 2 Pista: dav** ***** 30 segundos y 6636 Puntos [03:51] LibelulaBreve
2 Pista: dav** ***** 30 segundos y 6636 Puntos
[03:52] LibelulaBreve 3 Pista: davi* *o*ie 15 segundos y 6636 Puntos [03:52] LibelulaBreve
3 Pista: davi* *o*ie 15 segundos y 6636 Puntos
[03:52] Aguila}Torpe david wovie [03:52] Aguila}Torpe
david wovie
[03:52] LibelulaBreve Tiempo! La respuesta es -> david�owie <- [03:52] LibelulaBreve
Tiempo! La respuesta es -> david�owie <-
[03:52] LibelulaBreve R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708 [03:52] LibelulaBreve
R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708
[03:52] LibelulaBreve Tri.10061 Idiomasɴjmm.com˄etfranc鳃01wanespa񯬺c"Robinet"c?c [03:52] LibelulaBreve
Tri.10061 Idiomasɴjmm.com˄etfranc鳃01wanespa񯬺c"Robinet"c?c
[03:52] LibelulaBreve 1 Pista: ***** Pregunta de BONUS : 25000 Puntos [03:52] LibelulaBreve
1 Pista: ***** Pregunta de BONUS : 25000 Puntos
[03:52] LibelulaBreve 2 Pista: gri** 30 segundos y 25000 Puntos [03:52] LibelulaBreve
2 Pista: gri** 30 segundos y 25000 Puntos
[03:52] LibelulaBreve 3 Pista: gri*o 15 segundos y 25000 Puntos [03:52] LibelulaBreve
3 Pista: gri*o 15 segundos y 25000 Puntos
[03:53] Aguila}Torpe grito [03:53] Aguila}Torpe
grito
[03:53] LibelulaBreve Tiempo! La respuesta es -> grifo <- [03:53] LibelulaBreve
Tiempo! La respuesta es -> grifo <-
[03:53] LibelulaBreve For The Competitive Edge type !pingme [03:53] LibelulaBreve
For The Competitive Edge type !pingme
[03:53] LibelulaBreve Tri.4918 PersonajesɍARdeJAVA˿CU�eERAeELeSIGNOeDELeZODIACOeDEeLOSeSIGUIENTESePERSONAJESeCɌEBRES:eANTONIOeGAUDͬeFRANZeKAFKA,ePABLOeNERUDAeYeDIANAeDEeGALES?e?e [03:53] LibelulaBreve
Tri.4918 PersonajesɍARdeJAVA˿CU�eERAeELeSIGNOeDELeZODIACOeDEeLOSeSIGUIENTESePERSONAJESeCɌEBRES:eANTONIOeGAUDͬeFRANZeKAFKA,ePABLOeNERUDAeYeDIANAeDEeGALES?e?e
[03:53] LibelulaBreve 1 Pista: ****** Valor pregunta : 14267 Puntos [03:53] LibelulaBreve
1 Pista: ****** Valor pregunta : 14267 Puntos
[03:53] LibelulaBreve 2 Pista: can*** 30 segundos y 14267 Puntos [03:53] LibelulaBreve
2 Pista: can*** 30 segundos y 14267 Puntos
[03:53] Aguila}Torpe cancer [03:53] Aguila}Torpe
cancer
[03:53] LibelulaBreve �emuestra lo que sabes Aguila}Torpe! Has respondido "cancer" correctamente y eso te da: �4267�12 puntos [03:53] LibelulaBreve
�emuestra lo que sabes Aguila}Torpe! Has respondido "cancer" correctamente y eso te da: �4267�12 puntos
[03:53] LibelulaBreve Aguila}Torpe has acertado 3 seguidas!! Puntos HOY: 42955, SEMANA: 42955 y MES: 2383259 [03:53] LibelulaBreve
Aguila}Torpe has acertado 3 seguidas!! Puntos HOY: 42955, SEMANA: 42955 y MES: 2383259
[03:53] HormigaPedante cancer [03:53] HormigaPedante
cancer
[03:53] LibelulaBreve Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [03:53] LibelulaBreve
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[03:53] LibelulaBreve Tri.6972 Cienciaɶet˿(Matemᴩcas)matematicocfrancessdestacadocyrcartesianoc?a [03:53] LibelulaBreve
Tri.6972 Cienciaɶet˿(Matemᴩcas)matematicocfrancessdestacadocyrcartesianoc?a
[03:53] LibelulaBreve 1 Pista: ********* Valor pregunta : 22603 Puntos [03:53] LibelulaBreve
1 Pista: ********* Valor pregunta : 22603 Puntos
[03:54] LibelulaBreve 2 Pista: des****** 30 segundos y 22603 Puntos [03:54] LibelulaBreve
2 Pista: des****** 30 segundos y 22603 Puntos
[03:54] LibelulaBreve �Increible!! HormigaPedante contest󺠃04"descartes" en �6.25 segundos, y ha ganado �2603�12 puntos [03:54] LibelulaBreve
�Increible!! HormigaPedante contest󺠃04"descartes" en �6.25 segundos, y ha ganado �2603�12 puntos
[03:54] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:54] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:54] LibelulaBreve HormigaPedante has acertado 1 seguidas!! Puntos HOY: 832064, SEMANA: 832064 y MES: 8058308 [03:54] LibelulaBreve
HormigaPedante has acertado 1 seguidas!! Puntos HOY: 832064, SEMANA: 832064 y MES: 8058308
[03:54] HormigaPedante descartes [03:54] HormigaPedante
descartes
[03:54] LibelulaBreve R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 8035705 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2383259 #8: Gata_Suave 1150014 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404 [03:54] LibelulaBreve
R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 8035705 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2383259 #8: Gata_Suave 1150014 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404
[03:54] LibelulaBreve Tri.13864 CancionesɃarPEnTer˿Dekqu郰1igruponestlaacanci󮃰1r"99iwaysttondie"i?i [03:54] LibelulaBreve
Tri.13864 CancionesɃarPEnTer˿Dekqu郰1igruponestlaacanci󮃰1r"99iwaysttondie"i?i
[03:54] LibelulaBreve 1 Pista: ******** Valor pregunta : 9650 Puntos [03:54] LibelulaBreve
1 Pista: ******** Valor pregunta : 9650 Puntos
[03:54] Ardilla_Transparente DJ "karkamal" cierra peticiones [03:54] Ardilla_Transparente
DJ "karkamal" cierra peticiones
[03:54] LibelulaBreve 2 Pista: meg***** 30 segundos y 9650 Puntos [03:54] LibelulaBreve
2 Pista: meg***** 30 segundos y 9650 Puntos
[03:54] LibelulaBreve 3 Pista: mega*e** 15 segundos y 9650 Puntos [03:54] LibelulaBreve
3 Pista: mega*e** 15 segundos y 9650 Puntos
[03:55] LibelulaBreve Tiempo! La respuesta es -> megadeth <- [03:55] LibelulaBreve
Tiempo! La respuesta es -> megadeth <-
[03:55] LibelulaBreve Please refrain from using Extreme Bad Language [03:55] LibelulaBreve
Please refrain from using Extreme Bad Language
[03:55] LibelulaBreve Tri.1673 Idiomasɐax˿ComojsecdicecladletradRtenvelealfabetojfoneticoj(ingles)t?t [03:55] LibelulaBreve
Tri.1673 Idiomasɐax˿ComojsecdicecladletradRtenvelealfabetojfoneticoj(ingles)t?t
[03:55] LibelulaBreve 1 Pista: ***** Valor pregunta : 18078 Puntos [03:55] LibelulaBreve
1 Pista: ***** Valor pregunta : 18078 Puntos
[03:55] LibelulaBreve 2 Pista: Rom** 30 segundos y 18078 Puntos [03:55] LibelulaBreve
2 Pista: Rom** 30 segundos y 18078 Puntos
[03:55] HormigaPedante roma [03:55] HormigaPedante
roma
[03:55] LibelulaBreve 3 Pista: Romeo 15 segundos y 18078 Puntos [03:55] LibelulaBreve
3 Pista: Romeo 15 segundos y 18078 Puntos
[03:55] LibelulaBreve �Eso es HormigaPedante!! Dijiste: "romeo" y ello te ha valido: �8078�12 puntos [03:55] LibelulaBreve
�Eso es HormigaPedante!! Dijiste: "romeo" y ello te ha valido: �8078�12 puntos
[03:55] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:55] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:55] LibelulaBreve HormigaPedante has acertado 2 seguidas!! Puntos HOY: 850142, SEMANA: 850142 y MES: 8076386 [03:55] LibelulaBreve
HormigaPedante has acertado 2 seguidas!! Puntos HOY: 850142, SEMANA: 850142 y MES: 8076386
[03:55] HormigaPedante romeo [03:55] HormigaPedante
romeo
[03:56] LibelulaBreve This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve [03:56] LibelulaBreve
This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve
[03:56] LibelulaBreve Tri.20078 Arteɖivi˿Agqu郰1ghacebreferenciamlampalabramt魰era?g?g [03:56] LibelulaBreve
Tri.20078 Arteɖivi˿Agqu郰1ghacebreferenciamlampalabramt魰era?g?g
[03:56] LibelulaBreve 1 Pista: *** ******** ** ******* Valor pregunta : 12378 Puntos [03:56] LibelulaBreve
1 Pista: *** ******** ** ******* Valor pregunta : 12378 Puntos
[03:56] LibelulaBreve 2 Pista: una ******** ** ******* 30 segundos y 12378 Puntos [03:56] LibelulaBreve
2 Pista: una ******** ** ******* 30 segundos y 12378 Puntos
[03:56] LibelulaBreve 3 Pista: una *a*ie*a* *e *i**u*a 15 segundos y 12378 Puntos [03:56] LibelulaBreve
3 Pista: una *a*ie*a* *e *i**u*a 15 segundos y 12378 Puntos
[03:56] LibelulaBreve Tiempo! La respuesta es -> una�ariedad�e�intura <- [03:56] LibelulaBreve
Tiempo! La respuesta es -> una�ariedad�e�intura <-
[03:56] LibelulaBreve This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [03:56] LibelulaBreve
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[03:56] LibelulaBreve Tri.3606 Cotilleo-TVɳantisan˿C󭯃01wsecllamajelqcolegiowdeclajseriecCompa񥲯sa?x [03:56] LibelulaBreve
Tri.3606 Cotilleo-TVɳantisan˿C󭯃01wsecllamajelqcolegiowdeclajseriecCompa񥲯sa?x
[03:56] LibelulaBreve 1 Pista: ****** Valor pregunta : 24261 Puntos [03:56] LibelulaBreve
1 Pista: ****** Valor pregunta : 24261 Puntos
[03:57] LibelulaBreve 2 Pista: azc*** 30 segundos y 24261 Puntos [03:57] LibelulaBreve
2 Pista: azc*** 30 segundos y 24261 Puntos
[03:57] LibelulaBreve �emuestra lo que sabes HormigaPedante! Has respondido "azcona" correctamente y eso te da: �4261�12 puntos [03:57] LibelulaBreve
�emuestra lo que sabes HormigaPedante! Has respondido "azcona" correctamente y eso te da: �4261�12 puntos
[03:57] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:57] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:57] LibelulaBreve HormigaPedante has acertado 3 seguidas!! Puntos HOY: 874403, SEMANA: 874403 y MES: 8100647 [03:57] LibelulaBreve
HormigaPedante has acertado 3 seguidas!! Puntos HOY: 874403, SEMANA: 874403 y MES: 8100647
[03:57] HormigaPedante azcona [03:57] HormigaPedante
azcona
[03:57] LibelulaBreve Please remember this is a FREE service, Please do not complain [03:57] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[03:57] LibelulaBreve Tri.5052 GeografiaɍARdeJAVA˿DEeQUɃ01eREPڂLICAeRUSAeSEPTENTRIONAL,eLIM͔ROFEeCONeFINLANDIA,eESeCAPITALeLAeCIUDADeDEePETROZAVODSK?e?e [03:57] LibelulaBreve
Tri.5052 GeografiaɍARdeJAVA˿DEeQUɃ01eREPڂLICAeRUSAeSEPTENTRIONAL,eLIM͔ROFEeCONeFINLANDIA,eESeCAPITALeLAeCIUDADeDEePETROZAVODSK?e?e
[03:57] LibelulaBreve 1 Pista: ******* Valor pregunta : 18670 Puntos [03:57] LibelulaBreve
1 Pista: ******* Valor pregunta : 18670 Puntos
[03:57] LibelulaBreve 2 Pista: car**** 30 segundos y 18670 Puntos [03:57] LibelulaBreve
2 Pista: car**** 30 segundos y 18670 Puntos
[03:57] HormigaPedante carelia [03:57] HormigaPedante
carelia
[03:57] LibelulaBreve �Muy bien HormigaPedante!! Acertaste "carelia" en tan s󬯠�5.328 segundos y por eso has ganado: �8670�12 puntos [03:57] LibelulaBreve
�Muy bien HormigaPedante!! Acertaste "carelia" en tan s󬯠�5.328 segundos y por eso has ganado: �8670�12 puntos
[03:57] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [03:57] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[03:57] LibelulaBreve HormigaPedante has acertado 4 seguidas!! Puntos HOY: 893073, SEMANA: 893073 y MES: 8119317 [03:57] LibelulaBreve
HormigaPedante has acertado 4 seguidas!! Puntos HOY: 893073, SEMANA: 893073 y MES: 8119317
[03:58] LibelulaBreve This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 123071 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065 [03:58] LibelulaBreve
This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 123071 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065
[03:58] LibelulaBreve Tri.13868 Fisica-QuimicaɈdosO˿CUALoESoLAoUNIDADoDEoPODERoDESTRUCTIVOoDEoUNAoEXPLOSIONo?o [03:58] LibelulaBreve
Tri.13868 Fisica-QuimicaɈdosO˿CUALoESoLAoUNIDADoDEoPODERoDESTRUCTIVOoDEoUNAoEXPLOSIONo?o
[03:58] LibelulaBreve 1 Pista: ******* Valor pregunta : 16352 Puntos [03:58] LibelulaBreve
1 Pista: ******* Valor pregunta : 16352 Puntos
[03:58] LibelulaBreve 2 Pista: meg**** 30 segundos y 16352 Puntos [03:58] LibelulaBreve
2 Pista: meg**** 30 segundos y 16352 Puntos
[03:58] Aguila}Torpe megaton [03:58] Aguila}Torpe
megaton
[03:58] LibelulaBreve �Aguila}Torpe acert󡡠La respuesta era: "megaton" y contest󠥮 �4.344 segundos. Se lleva: �6352�12 puntos [03:58] LibelulaBreve
�Aguila}Torpe acert󡡠La respuesta era: "megaton" y contest󠥮 �4.344 segundos. Se lleva: �6352�12 puntos
[03:58] LibelulaBreve Aguila}Torpe has acertado 1 seguidas!! Puntos HOY: 59307, SEMANA: 59307 y MES: 2399611 [03:58] LibelulaBreve
Aguila}Torpe has acertado 1 seguidas!! Puntos HOY: 59307, SEMANA: 59307 y MES: 2399611
[03:58] LibelulaBreve R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 [03:58] LibelulaBreve
R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244
[03:58] LibelulaBreve Tri.5845 IdiomasɃocoman˿LATIN-INGLES:u߱uewsignificap"discriptio"?u?u [03:58] LibelulaBreve
Tri.5845 IdiomasɃocoman˿LATIN-INGLES:u߱uewsignificap"discriptio"?u?u
[03:58] LibelulaBreve 1 Pista: ************* Valor pregunta : 13290 Puntos [03:58] LibelulaBreve
1 Pista: ************* Valor pregunta : 13290 Puntos
[03:58] LibelulaBreve 2 Pista: cla********** 30 segundos y 13290 Puntos [03:58] LibelulaBreve
2 Pista: cla********** 30 segundos y 13290 Puntos
[03:59] LibelulaBreve 3 Pista: cla*i*i*a*io* 15 segundos y 13290 Puntos [03:59] LibelulaBreve
3 Pista: cla*i*i*a*io* 15 segundos y 13290 Puntos
[03:59] LibelulaBreve Tiempo! La respuesta es -> clasification <- [03:59] LibelulaBreve
Tiempo! La respuesta es -> clasification <-
[03:59] HormigaPedante clarificacion [03:59] HormigaPedante
clarificacion
[03:59] LibelulaBreve Top10 Players ( Weekly & Monthly ) are Auto-Voiced [03:59] LibelulaBreve
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[03:59] LibelulaBreve Tri.5455 Cotilleo-TVɅME^˿CӍOnSEnLLAMAnELnASESINOnDEnJOHNnLENNONn?n?n [03:59] LibelulaBreve
Tri.5455 Cotilleo-TVɅME^˿CӍOnSEnLLAMAnELnASESINOnDEnJOHNnLENNONn?n?n
[03:59] LibelulaBreve 1 Pista: ******* Valor pregunta : 7759 Puntos [03:59] LibelulaBreve
1 Pista: ******* Valor pregunta : 7759 Puntos
[03:59] LibelulaBreve 2 Pista: cha**** 30 segundos y 7759 Puntos [03:59] LibelulaBreve
2 Pista: cha**** 30 segundos y 7759 Puntos
[04:00] LibelulaBreve 3 Pista: cha**a* 15 segundos y 7759 Puntos [04:00] LibelulaBreve
3 Pista: cha**a* 15 segundos y 7759 Puntos
[04:00] LibelulaBreve Tiempo! La respuesta es -> chapman <- [04:00] LibelulaBreve
Tiempo! La respuesta es -> chapman <-
[04:00] LibelulaBreve Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [04:00] LibelulaBreve
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[04:00] LibelulaBreve Tri.11591 Cotilleo-TVɨupper˿(DIBUJOS)QUExPERSONAJExDELxCARTOONxNETWORKxLIGAxCASIxTODAxLAxSEMANAx?x [04:00] LibelulaBreve
Tri.11591 Cotilleo-TVɨupper˿(DIBUJOS)QUExPERSONAJExDELxCARTOONxNETWORKxLIGAxCASIxTODAxLAxSEMANAx?x
[04:00] LibelulaBreve 1 Pista: ****** ***** Valor pregunta : 10750 Puntos [04:00] LibelulaBreve
1 Pista: ****** ***** Valor pregunta : 10750 Puntos
[04:00] LibelulaBreve 2 Pista: joh*** ***** 30 segundos y 10750 Puntos [04:00] LibelulaBreve
2 Pista: joh*** ***** 30 segundos y 10750 Puntos
[04:00] LibelulaBreve 3 Pista: joh*** **a*o 15 segundos y 10750 Puntos [04:00] LibelulaBreve
3 Pista: joh*** **a*o 15 segundos y 10750 Puntos
[04:01] LibelulaBreve Tiempo! La respuesta es -> johnny�ravo <- [04:01] LibelulaBreve
Tiempo! La respuesta es -> johnny�ravo <-
[04:01] LibelulaBreve Tri.419 Cienciaɳtephenwo˿Enjquega񯃰1dlanzodRusiavlavestaci󮃰1jespacialkMir?q?q [04:01] LibelulaBreve
Tri.419 Cienciaɳtephenwo˿Enjquega񯃰1dlanzodRusiavlavestaci󮃰1jespacialkMir?q?q
[04:01] LibelulaBreve 1 Pista: **** Valor pregunta : 12083 Puntos [04:01] LibelulaBreve
1 Pista: **** Valor pregunta : 12083 Puntos
[04:01] LibelulaBreve 2 Pista: 198* 30 segundos y 12083 Puntos [04:01] LibelulaBreve
2 Pista: 198* 30 segundos y 12083 Puntos
[04:01] HormigaPedante 1982 [04:01] HormigaPedante
1982
[04:01] LibelulaBreve �Increible!! Aguila}Torpe contest󺠃04"1986" en �9.297 segundos, y ha ganado �2083�12 puntos [04:01] LibelulaBreve
�Increible!! Aguila}Torpe contest󺠃04"1986" en �9.297 segundos, y ha ganado �2083�12 puntos
[04:01] LibelulaBreve Aguila}Torpe has acertado 2 seguidas!! Puntos HOY: 71390, SEMANA: 71390 y MES: 2411694 [04:01] LibelulaBreve
Aguila}Torpe has acertado 2 seguidas!! Puntos HOY: 71390, SEMANA: 71390 y MES: 2411694
[04:01] Aguila}Torpe 1986 [04:01] Aguila}Torpe
1986
[04:02] LibelulaBreve We feature over 50,000 Q&A ! [04:02] LibelulaBreve
We feature over 50,000 Q&A !
[04:02] LibelulaBreve Tri.1836 Informaticaɐax˿C󭯃01usekllamaheloreproductorfdekMP3vdelotama񯃰1udekunahtarjetahdekcr餩toudekSamsungg?v [04:02] LibelulaBreve
Tri.1836 Informaticaɐax˿C󭯃01usekllamaheloreproductorfdekMP3vdelotama񯃰1udekunahtarjetahdekcr餩toudekSamsungg?v
[04:02] LibelulaBreve 1 Pista: **** Valor pregunta : 12654 Puntos [04:02] LibelulaBreve
1 Pista: **** Valor pregunta : 12654 Puntos
[04:02] LibelulaBreve 2 Pista: Yep* 30 segundos y 12654 Puntos [04:02] LibelulaBreve
2 Pista: Yep* 30 segundos y 12654 Puntos
[04:02] LibelulaBreve 3 Pista: Yep* 15 segundos y 12654 Puntos [04:02] LibelulaBreve
3 Pista: Yep* 15 segundos y 12654 Puntos
[04:02] HormigaPedante epe [04:02] HormigaPedante
epe
[04:02] HormigaPedante yepe [04:02] HormigaPedante
yepe
[04:02] HormigaPedante yepi [04:02] HormigaPedante
yepi
[04:02] LibelulaBreve Tiempo! La respuesta es -> Yepp <- [04:02] LibelulaBreve
Tiempo! La respuesta es -> Yepp <-
[04:02] LibelulaBreve Tri.15406 Informaticaɐax˿Cualuesolaulongitudlmaximaudesunauetiquetaudesdiscodduro?w(endcaracteres)w?w [04:02] LibelulaBreve
Tri.15406 Informaticaɐax˿Cualuesolaulongitudlmaximaudesunauetiquetaudesdiscodduro?w(endcaracteres)w?w
[04:02] LibelulaBreve 1 Pista: **** Valor pregunta : 15887 Puntos [04:02] LibelulaBreve
1 Pista: **** Valor pregunta : 15887 Puntos
[04:03] LibelulaBreve 2 Pista: onc* 30 segundos y 15887 Puntos [04:03] LibelulaBreve
2 Pista: onc* 30 segundos y 15887 Puntos
[04:03] LibelulaBreve �Bien HormigaPedante!! Tu respuesta: "once" es correcta y ganas �5887�12 puntos [04:03] LibelulaBreve
�Bien HormigaPedante!! Tu respuesta: "once" es correcta y ganas �5887�12 puntos
[04:03] LibelulaBreve ACTION Aplausos HormigaPedante una Pepsi y pizza por 900000 victorias!! Ole HormigaPedante!!! [04:03] LibelulaBreve
ACTION Aplausos HormigaPedante una Pepsi y pizza por 900000 victorias!! Ole HormigaPedante!!!
[04:03] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [04:03] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[04:03] LibelulaBreve HormigaPedante has acertado 1 seguidas!! Puntos HOY: 908960, SEMANA: 908960 y MES: 8135204 [04:03] LibelulaBreve
HormigaPedante has acertado 1 seguidas!! Puntos HOY: 908960, SEMANA: 908960 y MES: 8135204
[04:03] HormigaPedante once [04:03] HormigaPedante
once
[04:03] LibelulaBreve Tri.17949 PersonajesɟSibila_˿DӎDEvESTUVOvEXILIADOvMAQUIAVELO?v?v [04:03] LibelulaBreve
Tri.17949 PersonajesɟSibila_˿DӎDEvESTUVOvEXILIADOvMAQUIAVELO?v?v
[04:03] LibelulaBreve 1 Pista: *** ********* Valor pregunta : 10112 Puntos [04:03] LibelulaBreve
1 Pista: *** ********* Valor pregunta : 10112 Puntos
[04:03] HormigaPedante me voy  que la pasen bien [04:03] HormigaPedante
me voy  que la pasen bien
[04:03] LibelulaBreve 2 Pista: san ********* 30 segundos y 10112 Puntos [04:03] LibelulaBreve
2 Pista: san ********* 30 segundos y 10112 Puntos
[04:03] LibelulaBreve 3 Pista: san *i*i*ia*o 15 segundos y 10112 Puntos [04:03] LibelulaBreve
3 Pista: san *i*i*ia*o 15 segundos y 10112 Puntos
[04:04] Ardilla_Transparente 📻 Finalizando emisión. Vuelve el AutoDJ. [04:04] Ardilla_Transparente
📻 Finalizando emisión. Vuelve el AutoDJ.
[04:04] HormigaPedante san casiano [04:04] HormigaPedante
san casiano
[04:04] LibelulaBreve Tiempo! La respuesta es -> san�iminiano <- [04:04] LibelulaBreve
Tiempo! La respuesta es -> san�iminiano <-
[04:04] LibelulaBreve Please remember this is a FREE service, Please do not complain [04:04] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[04:04] LibelulaBreve Tri.4112 MiscelaneaɔeLaRaNhA˿Comidalquefescaseal?o [04:04] LibelulaBreve
Tri.4112 MiscelaneaɔeLaRaNhA˿Comidalquefescaseal?o
[04:04] LibelulaBreve 1 Pista: **** ** ******* Valor pregunta : 17247 Puntos [04:04] LibelulaBreve
1 Pista: **** ** ******* Valor pregunta : 17247 Puntos
[04:04] LibelulaBreve 2 Pista: bie* ** ******* 30 segundos y 17247 Puntos [04:04] LibelulaBreve
2 Pista: bie* ** ******* 30 segundos y 17247 Puntos
[04:04] LibelulaBreve 3 Pista: bie* *e *a*o*ea 15 segundos y 17247 Puntos [04:04] LibelulaBreve
3 Pista: bie* *e *a*o*ea 15 segundos y 17247 Puntos
[04:05] LibelulaBreve �e nota que sabes mucho de esto HormigaPedante! Tu respuesta "bien se saborea" es correcta y ganas �7247�12 puntos [04:05] LibelulaBreve
�e nota que sabes mucho de esto HormigaPedante! Tu respuesta "bien se saborea" es correcta y ganas �7247�12 puntos
[04:05] LibelulaBreve ACTION awards HormigaPedante with a +v for having over 15000 points [04:05] LibelulaBreve
ACTION awards HormigaPedante with a +v for having over 15000 points
[04:05] LibelulaBreve HormigaPedante has acertado 2 seguidas!! Puntos HOY: 926207, SEMANA: 926207 y MES: 8152451 [04:05] LibelulaBreve
HormigaPedante has acertado 2 seguidas!! Puntos HOY: 926207, SEMANA: 926207 y MES: 8152451
[04:05] HormigaPedante bien se saborea [04:05] HormigaPedante
bien se saborea
[04:05] LibelulaBreve R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663 [04:05] LibelulaBreve
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663
[04:05] LibelulaBreve Tri.7375 Biologiaɖivian˿C󭯃01rseillamabavlavprimeravovejavclonada?n?n [04:05] LibelulaBreve
Tri.7375 Biologiaɖivian˿C󭯃01rseillamabavlavprimeravovejavclonada?n?n
[04:05] LibelulaBreve 1 Pista: ***** Valor pregunta : 22095 Puntos [04:05] LibelulaBreve
1 Pista: ***** Valor pregunta : 22095 Puntos
[04:05] LibelulaBreve 2 Pista: dol** 30 segundos y 22095 Puntos [04:05] LibelulaBreve
2 Pista: dol** 30 segundos y 22095 Puntos
[04:05] LibelulaBreve 3 Pista: dol** 15 segundos y 22095 Puntos [04:05] LibelulaBreve
3 Pista: dol** 15 segundos y 22095 Puntos
[04:05] Aguila}Torpe dolig [04:05] Aguila}Torpe
dolig
[04:05] Aguila}Torpe dolin [04:05] Aguila}Torpe
dolin
[04:05] LibelulaBreve Tiempo! La respuesta es -> dolly <- [04:05] LibelulaBreve
Tiempo! La respuesta es -> dolly <-
[04:06] LibelulaBreve If you think a Q&A is wrong, please call an OP [04:06] LibelulaBreve
If you think a Q&A is wrong, please call an OP
[04:06] LibelulaBreve Tri.4033 Fisica-QuimicaɉSA˿Conwquepotroinombrepsepconocepelfbencenoi?i [04:06] LibelulaBreve
Tri.4033 Fisica-QuimicaɉSA˿Conwquepotroinombrepsepconocepelfbencenoi?i
[04:06] LibelulaBreve 1 Pista: ****** Pregunta de BONUS : 200000 Puntos [04:06] LibelulaBreve
1 Pista: ****** Pregunta de BONUS : 200000 Puntos
[04:06] LibelulaBreve 2 Pista: ben*** 30 segundos y 200000 Puntos [04:06] LibelulaBreve
2 Pista: ben*** 30 segundos y 200000 Puntos
[04:06] LibelulaBreve 3 Pista: ben*o* 15 segundos y 200000 Puntos [04:06] LibelulaBreve
3 Pista: ben*o* 15 segundos y 200000 Puntos
[04:06] LibelulaBreve Tiempo! La respuesta es -> benzol <- [04:06] LibelulaBreve
Tiempo! La respuesta es -> benzol <-
[04:07] LibelulaBreve R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708 [04:07] LibelulaBreve
R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708
[04:07] LibelulaBreve Tri.10405 Fisica-QuimicaɔeLaRaNhA˅lectr󮩣a:yߕnidadadejinductancianelectrican?y [04:07] LibelulaBreve
Tri.10405 Fisica-QuimicaɔeLaRaNhA˅lectr󮩣a:yߕnidadadejinductancianelectrican?y
[04:07] LibelulaBreve 1 Pista: ****** Valor pregunta : 23284 Puntos [04:07] LibelulaBreve
1 Pista: ****** Valor pregunta : 23284 Puntos
[04:07] LibelulaBreve 2 Pista: hen*** 30 segundos y 23284 Puntos [04:07] LibelulaBreve
2 Pista: hen*** 30 segundos y 23284 Puntos
[04:07] LibelulaBreve �Ol頃04Aguila}Torpe!! Has contestado: "henrio" en �5.891 segundos y sumas �3284�12 puntos a tu marcador. �Sigue as� [04:07] LibelulaBreve
�Ol頃04Aguila}Torpe!! Has contestado: "henrio" en �5.891 segundos y sumas �3284�12 puntos a tu marcador. �Sigue as�
[04:07] LibelulaBreve Aguila}Torpe has acertado 1 seguidas!! Puntos HOY: 94674, SEMANA: 94674 y MES: 2434978 [04:07] LibelulaBreve
Aguila}Torpe has acertado 1 seguidas!! Puntos HOY: 94674, SEMANA: 94674 y MES: 2434978
[04:07] Aguila}Torpe henrio [04:07] Aguila}Torpe
henrio
[04:07] LibelulaBreve For The Competitive Edge type !pingme [04:07] LibelulaBreve
For The Competitive Edge type !pingme
[04:07] LibelulaBreve Tri.7321 Arteɣuchi-˿ARQUITECTURA:cQUEcESPESORc-cENcCENTIMETROSc-cTIENEcUNAcFABRICAcDEcLADRILLOScDEc"MEDIAcASTA"c?c [04:07] LibelulaBreve
Tri.7321 Arteɣuchi-˿ARQUITECTURA:cQUEcESPESORc-cENcCENTIMETROSc-cTIENEcUNAcFABRICAcDEcLADRILLOScDEc"MEDIAcASTA"c?c
[04:07] LibelulaBreve 1 Pista: **** Valor pregunta : 17844 Puntos [04:07] LibelulaBreve
1 Pista: **** Valor pregunta : 17844 Puntos
[04:07] LibelulaBreve 2 Pista: doc* 30 segundos y 17844 Puntos [04:07] LibelulaBreve
2 Pista: doc* 30 segundos y 17844 Puntos
[04:07] LibelulaBreve �Increible!! Aguila}Torpe contest󺠃04"doce" en �9.234 segundos, y ha ganado �7844�12 puntos [04:07] LibelulaBreve
�Increible!! Aguila}Torpe contest󺠃04"doce" en �9.234 segundos, y ha ganado �7844�12 puntos
[04:07] LibelulaBreve Aguila}Torpe has acertado 2 seguidas!! Puntos HOY: 112518, SEMANA: 112518 y MES: 2452822 [04:07] LibelulaBreve
Aguila}Torpe has acertado 2 seguidas!! Puntos HOY: 112518, SEMANA: 112518 y MES: 2452822
[04:07] Aguila}Torpe doce [04:07] Aguila}Torpe
doce
[04:08] LibelulaBreve Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [04:08] LibelulaBreve
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[04:08] LibelulaBreve Tri.2379 Arteɋwahamot˿Ayquefdisc�lobdefFidiaslsefdebefelqgrupobescult󲩣ob"ProcnefefItys"y?y [04:08] LibelulaBreve
Tri.2379 Arteɋwahamot˿Ayquefdisc�lobdefFidiaslsefdebefelqgrupobescult󲩣ob"ProcnefefItys"y?y
[04:08] LibelulaBreve 1 Pista: ********* Valor pregunta : 15970 Puntos [04:08] LibelulaBreve
1 Pista: ********* Valor pregunta : 15970 Puntos
[04:08] LibelulaBreve 2 Pista: alc****** 30 segundos y 15970 Puntos [04:08] LibelulaBreve
2 Pista: alc****** 30 segundos y 15970 Puntos
[04:08] LibelulaBreve 3 Pista: alca*e*e* 15 segundos y 15970 Puntos [04:08] LibelulaBreve
3 Pista: alca*e*e* 15 segundos y 15970 Puntos
[04:08] LibelulaBreve Tiempo! La respuesta es -> alcamenes <- [04:08] LibelulaBreve
Tiempo! La respuesta es -> alcamenes <-
[04:09] LibelulaBreve R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 8152451 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2452822 #8: Gata_Suave 1150014 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404 [04:09] LibelulaBreve
R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 8152451 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2452822 #8: Gata_Suave 1150014 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404
[04:09] LibelulaBreve Tri.18433 PersonajesɈache˿Cuᬃ01gfueylafcausafdeylafmuerteydelgpoetafJaimeyGilgdeyBiedmafenvelga񯃰1v1992n?n [04:09] LibelulaBreve
Tri.18433 PersonajesɈache˿Cuᬃ01gfueylafcausafdeylafmuerteydelgpoetafJaimeyGilgdeyBiedmafenvelga񯃰1v1992n?n
[04:09] LibelulaBreve 1 Pista: **** Valor pregunta : 19710 Puntos [04:09] LibelulaBreve
1 Pista: **** Valor pregunta : 19710 Puntos
[04:09] LibelulaBreve 2 Pista: sid* 30 segundos y 19710 Puntos [04:09] LibelulaBreve
2 Pista: sid* 30 segundos y 19710 Puntos
[04:09] LibelulaBreve 3 Pista: sida 15 segundos y 19710 Puntos [04:09] LibelulaBreve
3 Pista: sida 15 segundos y 19710 Puntos
[04:09] LibelulaBreve �Absolutamente correcto Aguila}Torpe!! Acertaste "sida" en �3.297 segundos y ganas �9710�12 puntos [04:09] LibelulaBreve
�Absolutamente correcto Aguila}Torpe!! Acertaste "sida" en �3.297 segundos y ganas �9710�12 puntos
[04:09] LibelulaBreve Aguila}Torpe has acertado 3 seguidas!! Puntos HOY: 132228, SEMANA: 132228 y MES: 2472532 [04:09] LibelulaBreve
Aguila}Torpe has acertado 3 seguidas!! Puntos HOY: 132228, SEMANA: 132228 y MES: 2472532
[04:09] Aguila}Torpe sida [04:09] Aguila}Torpe
sida
[04:09] LibelulaBreve Please refrain from using Extreme Bad Language [04:09] LibelulaBreve
Please refrain from using Extreme Bad Language
[04:09] LibelulaBreve Tri.16533 Idiomasɳorgo˿HUTAdEQUIVALEdENdESPAяLdAdCABAс.ENdQUEdIDIOMAdESTA?d?d [04:09] LibelulaBreve
Tri.16533 Idiomasɳorgo˿HUTAdEQUIVALEdENdESPAяLdAdCABAс.ENdQUEdIDIOMAdESTA?d?d
[04:09] LibelulaBreve 1 Pista: ****** Valor pregunta : 16242 Puntos [04:09] LibelulaBreve
1 Pista: ****** Valor pregunta : 16242 Puntos
[04:10] LibelulaBreve 2 Pista: pol*** 30 segundos y 16242 Puntos [04:10] LibelulaBreve
2 Pista: pol*** 30 segundos y 16242 Puntos
[04:10] LibelulaBreve 3 Pista: pola*o 15 segundos y 16242 Puntos [04:10] LibelulaBreve
3 Pista: pola*o 15 segundos y 16242 Puntos
[04:10] LibelulaBreve �As�e hace Aguila}Torpe!! Contestaste "polaco" en �7.063 segundos y sumas �6242�12 puntos [04:10] LibelulaBreve
�As�e hace Aguila}Torpe!! Contestaste "polaco" en �7.063 segundos y sumas �6242�12 puntos
[04:10] Aguila}Torpe polaco [04:10] Aguila}Torpe
polaco
[04:10] LibelulaBreve Aguila}Torpe has acertado 4 seguidas!! Puntos HOY: 148470, SEMANA: 148470 y MES: 2488774 [04:10] LibelulaBreve
Aguila}Torpe has acertado 4 seguidas!! Puntos HOY: 148470, SEMANA: 148470 y MES: 2488774
[04:10] LibelulaBreve This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve [04:10] LibelulaBreve
This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve
[04:10] LibelulaBreve Tri.2540 Arteɣarlovigo˿ComohsezllamamlamdirectoramdelcBalletmNacionalcdezCuba?n?n [04:10] LibelulaBreve
Tri.2540 Arteɣarlovigo˿ComohsezllamamlamdirectoramdelcBalletmNacionalcdezCuba?n?n
[04:10] LibelulaBreve 1 Pista: ****** ****** Valor pregunta : 6856 Puntos [04:10] LibelulaBreve
1 Pista: ****** ****** Valor pregunta : 6856 Puntos
[04:10] LibelulaBreve 2 Pista: ali*** ****** 30 segundos y 6856 Puntos [04:10] LibelulaBreve
2 Pista: ali*** ****** 30 segundos y 6856 Puntos
[04:11] LibelulaBreve 3 Pista: ali*ia a*o**o 15 segundos y 6856 Puntos [04:11] LibelulaBreve
3 Pista: ali*ia a*o**o 15 segundos y 6856 Puntos
[04:11] Aguila}Torpe alicia alonso [04:11] Aguila}Torpe
alicia alonso
[04:11] LibelulaBreve �emuestra lo que sabes Aguila}Torpe! Has respondido "alicia alonso" correctamente y eso te da: �856�12 puntos [04:11] LibelulaBreve
�emuestra lo que sabes Aguila}Torpe! Has respondido "alicia alonso" correctamente y eso te da: �856�12 puntos
[04:11] LibelulaBreve Aguila}Torpe has acertado 5 seguidas!! Puntos HOY: 155326, SEMANA: 155326 y MES: 2495630 [04:11] LibelulaBreve
Aguila}Torpe has acertado 5 seguidas!! Puntos HOY: 155326, SEMANA: 155326 y MES: 2495630
[04:11] LibelulaBreve This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [04:11] LibelulaBreve
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[04:11] LibelulaBreve Tri.14402 ArteɐEDROC˿ELdCUADROdIMPRESION,dSOLdNACIENTEdDIOdNOMBREdALdIMPRESIONISMO.dSUdAUTORdFUE?d?d [04:11] LibelulaBreve
Tri.14402 ArteɐEDROC˿ELdCUADROdIMPRESION,dSOLdNACIENTEdDIOdNOMBREdALdIMPRESIONISMO.dSUdAUTORdFUE?d?d
[04:11] LibelulaBreve 1 Pista: ***** Valor pregunta : 14333 Puntos [04:11] LibelulaBreve
1 Pista: ***** Valor pregunta : 14333 Puntos
[04:11] LibelulaBreve 2 Pista: mon** 30 segundos y 14333 Puntos [04:11] LibelulaBreve
2 Pista: mon** 30 segundos y 14333 Puntos
[04:12] LibelulaBreve 3 Pista: mone* 15 segundos y 14333 Puntos [04:12] LibelulaBreve
3 Pista: mone* 15 segundos y 14333 Puntos
[04:12] Aguila}Torpe monet [04:12] Aguila}Torpe
monet
[04:12] LibelulaBreve �Suma y sigue Aguila}Torpe!! La respuesta: "monet" incrementa tu marcador en �4333�12 puntos [04:12] LibelulaBreve
�Suma y sigue Aguila}Torpe!! La respuesta: "monet" incrementa tu marcador en �4333�12 puntos
[04:12] LibelulaBreve Aguila}Torpe has acertado 6 seguidas!! Puntos HOY: 169659, SEMANA: 169659 y MES: 2509963 [04:12] LibelulaBreve
Aguila}Torpe has acertado 6 seguidas!! Puntos HOY: 169659, SEMANA: 169659 y MES: 2509963
[04:12] LibelulaBreve Please remember this is a FREE service, Please do not complain [04:12] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[04:12] LibelulaBreve Tri.1163 HistoriaɊAVEA˿02/11/1998:QUEaPAISaEUROPEOaESaLAaQUEaESTADOSaUNIDOSaSEaRESISTEaACEPTARaQUEaSEAaELaPORTAVOZaDELaEUROa?a [04:12] LibelulaBreve
Tri.1163 HistoriaɊAVEA˿02/11/1998:QUEaPAISaEUROPEOaESaLAaQUEaESTADOSaUNIDOSaSEaRESISTEaACEPTARaQUEaSEAaELaPORTAVOZaDELaEUROa?a
[04:12] LibelulaBreve 1 Pista: ****Ѫ Valor pregunta : 14431 Puntos [04:12] LibelulaBreve
1 Pista: ****Ѫ Valor pregunta : 14431 Puntos
[04:12] LibelulaBreve 2 Pista: ESP*Ѫ 30 segundos y 14431 Puntos [04:12] LibelulaBreve
2 Pista: ESP*Ѫ 30 segundos y 14431 Puntos
[04:12] Aguila}Torpe espa�a [04:12] Aguila}Torpe
espa�a
[04:12] Aguila}Torpe ESPAс [04:12] Aguila}Torpe
ESPAс
[04:12] LibelulaBreve �Increible!! Aguila}Torpe contest󺠃04"ESPAс" en �5.578 segundos, y ha ganado �4431�12 puntos [04:12] LibelulaBreve
�Increible!! Aguila}Torpe contest󺠃04"ESPAс" en �5.578 segundos, y ha ganado �4431�12 puntos
[04:12] LibelulaBreve Aguila}Torpe has acertado 7 seguidas!! Puntos HOY: 184090, SEMANA: 184090 y MES: 2524394 [04:12] LibelulaBreve
Aguila}Torpe has acertado 7 seguidas!! Puntos HOY: 184090, SEMANA: 184090 y MES: 2524394
[04:12] LibelulaBreve This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 123071 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065 [04:12] LibelulaBreve
This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 123071 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065
[04:12] LibelulaBreve Tri.16358 PoliticaɁnghara˿Autorapdeslapbiograf�01pdeslapreinap(nombresydapellido)p?p [04:12] LibelulaBreve
Tri.16358 PoliticaɁnghara˿Autorapdeslapbiograf�01pdeslapreinap(nombresydapellido)p?p
[04:12] LibelulaBreve 1 Pista: ***** ****** Pregunta de BONUS : 50000 Puntos [04:12] LibelulaBreve
1 Pista: ***** ****** Pregunta de BONUS : 50000 Puntos
[04:13] LibelulaBreve 2 Pista: pil** ****** 30 segundos y 50000 Puntos [04:13] LibelulaBreve
2 Pista: pil** ****** 30 segundos y 50000 Puntos
[04:13] LibelulaBreve 3 Pista: pila* u**a*o 15 segundos y 50000 Puntos [04:13] LibelulaBreve
3 Pista: pila* u**a*o 15 segundos y 50000 Puntos
[04:13] Aguila}Torpe pilar urbano [04:13] Aguila}Torpe
pilar urbano
[04:13] LibelulaBreve �Enhorabuena Aguila}Torpe!! Has contestado "pilar urbano" y por ello has ganado �0000�12 puntos [04:13] LibelulaBreve
�Enhorabuena Aguila}Torpe!! Has contestado "pilar urbano" y por ello has ganado �0000�12 puntos
[04:13] LibelulaBreve Aguila}Torpe has acertado 8 seguidas!! Puntos HOY: 234090, SEMANA: 234090 y MES: 2574394 [04:13] LibelulaBreve
Aguila}Torpe has acertado 8 seguidas!! Puntos HOY: 234090, SEMANA: 234090 y MES: 2574394
[04:13] LibelulaBreve R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 [04:13] LibelulaBreve
R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244
[04:13] LibelulaBreve Tri.17562 ArteɂRUJI˿ENpQUEpEMBLEMATICOpEDIFICIOpAMERICANOpSEpENCUENTRANpPINTURASpMURALESpDEpJOSEPpMARIApSERT?p?p [04:13] LibelulaBreve
Tri.17562 ArteɂRUJI˿ENpQUEpEMBLEMATICOpEDIFICIOpAMERICANOpSEpENCUENTRANpPINTURASpMURALESpDEpJOSEPpMARIApSERT?p?p
[04:13] LibelulaBreve 1 Pista: *********** ****** Pregunta de BONUS : 25000 Puntos [04:13] LibelulaBreve
1 Pista: *********** ****** Pregunta de BONUS : 25000 Puntos
[04:14] LibelulaBreve 2 Pista: roc******** ****** 30 segundos y 25000 Puntos [04:14] LibelulaBreve
2 Pista: roc******** ****** 30 segundos y 25000 Puntos
[04:14] LibelulaBreve 3 Pista: roc*e*e**e* *e**e* 15 segundos y 25000 Puntos [04:14] LibelulaBreve
3 Pista: roc*e*e**e* *e**e* 15 segundos y 25000 Puntos
[04:14] Aguila}Torpe rockefeller centre [04:14] Aguila}Torpe
rockefeller centre
[04:14] LibelulaBreve Tiempo! La respuesta es -> rockefeller�enter <- [04:14] LibelulaBreve
Tiempo! La respuesta es -> rockefeller�enter <-
[04:14] LibelulaBreve Top10 Players ( Weekly & Monthly ) are Auto-Voiced [04:14] LibelulaBreve
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[04:14] LibelulaBreve Tri.20810 Personajesɦlipp_er˿EnqqueasigloinacioielpfilosofoiKant?f?f [04:14] LibelulaBreve
Tri.20810 Personajesɦlipp_er˿EnqqueasigloinacioielpfilosofoiKant?f?f
[04:14] LibelulaBreve 1 Pista: ***** Valor pregunta : 17277 Puntos [04:14] LibelulaBreve
1 Pista: ***** Valor pregunta : 17277 Puntos
[04:14] LibelulaBreve 2 Pista: xvi** 30 segundos y 17277 Puntos [04:14] LibelulaBreve
2 Pista: xvi** 30 segundos y 17277 Puntos
[04:15] Aguila}Torpe xviii [04:15] Aguila}Torpe
xviii
[04:15] LibelulaBreve �Bingo!! Aguila}Torpe dio la respuesta: "xviii" en �2.562 segundos e incrementa sus ganancias con �7277�12 puntos [04:15] LibelulaBreve
�Bingo!! Aguila}Torpe dio la respuesta: "xviii" en �2.562 segundos e incrementa sus ganancias con �7277�12 puntos
[04:15] LibelulaBreve Aguila}Torpe has acertado 9 seguidas!! Puntos HOY: 251367, SEMANA: 251367 y MES: 2591671 [04:15] LibelulaBreve
Aguila}Torpe has acertado 9 seguidas!! Puntos HOY: 251367, SEMANA: 251367 y MES: 2591671
[04:15] LibelulaBreve Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [04:15] LibelulaBreve
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[04:15] LibelulaBreve Tri.12270 Politicaɳipynop˿C󭯃01qseaconoceafamiliarmenteaaclacConstituci󮃰1vespa񯬡cdea1812k?k [04:15] LibelulaBreve
Tri.12270 Politicaɳipynop˿C󭯃01qseaconoceafamiliarmenteaaclacConstituci󮃰1vespa񯬡cdea1812k?k
[04:15] LibelulaBreve 1 Pista: ** **** Pregunta de BONUS : 100000 Puntos [04:15] LibelulaBreve
1 Pista: ** **** Pregunta de BONUS : 100000 Puntos
[04:15] LibelulaBreve 2 Pista: la�*** 30 segundos y 100000 Puntos [04:15] LibelulaBreve
2 Pista: la�*** 30 segundos y 100000 Puntos
[04:15] LibelulaBreve 3 Pista: la�e*a 15 segundos y 100000 Puntos [04:15] LibelulaBreve
3 Pista: la�e*a 15 segundos y 100000 Puntos
[04:15] LibelulaBreve Tiempo! La respuesta es -> la�epa <- [04:15] LibelulaBreve
Tiempo! La respuesta es -> la�epa <-
[04:16] LibelulaBreve Tri.4430 Musicaɰamo˿C󭯃01zsehtitul󃰱aeloprimerwL.P.adehU2a?a [04:16] LibelulaBreve
Tri.4430 Musicaɰamo˿C󭯃01zsehtitul󃰱aeloprimerwL.P.adehU2a?a
[04:16] LibelulaBreve 1 Pista: *** Pregunta de BONUS : 200000 Puntos [04:16] LibelulaBreve
1 Pista: *** Pregunta de BONUS : 200000 Puntos
[04:16] LibelulaBreve 2 Pista: boy 30 segundos y 200000 Puntos [04:16] LibelulaBreve
2 Pista: boy 30 segundos y 200000 Puntos
[04:16] Aguila}Torpe boy [04:16] Aguila}Torpe
boy
[04:16] LibelulaBreve �Suma y sigue Aguila}Torpe!! La respuesta: "boy" incrementa tu marcador en �00000�12 puntos [04:16] LibelulaBreve
�Suma y sigue Aguila}Torpe!! La respuesta: "boy" incrementa tu marcador en �00000�12 puntos
[04:16] LibelulaBreve Aguila}Torpe has acertado 10 seguidas!! Puntos HOY: 451367, SEMANA: 451367 y MES: 2791671 [04:16] LibelulaBreve
Aguila}Torpe has acertado 10 seguidas!! Puntos HOY: 451367, SEMANA: 451367 y MES: 2791671
[04:16] LibelulaBreve Bonus especial de 50000 Puntos para Aguila}Torpe por acertar 10 seguidas!!! [04:16] LibelulaBreve
Bonus especial de 50000 Puntos para Aguila}Torpe por acertar 10 seguidas!!!
[04:16] LibelulaBreve We feature over 50,000 Q&A ! [04:16] LibelulaBreve
We feature over 50,000 Q&A !
[04:16] LibelulaBreve Tri.18493 CancionesɍarcaAcme˿ComoesegllamacelkCDzdegLimprBizkitlquegtienegelktemac"BreakhStuff"zyv"Nookie"z?"z?z [04:16] LibelulaBreve
Tri.18493 CancionesɍarcaAcme˿ComoesegllamacelkCDzdegLimprBizkitlquegtienegelktemac"BreakhStuff"zyv"Nookie"z?"z?z
[04:16] LibelulaBreve 1 Pista: *********** ***** Pregunta de BONUS : 25000 Puntos [04:16] LibelulaBreve
1 Pista: *********** ***** Pregunta de BONUS : 25000 Puntos
[04:16] LibelulaBreve 2 Pista: sig******** ***** 30 segundos y 25000 Puntos [04:16] LibelulaBreve
2 Pista: sig******** ***** 30 segundos y 25000 Puntos
[04:17] LibelulaBreve 3 Pista: sig*i*i*a** o**e* 15 segundos y 25000 Puntos [04:17] LibelulaBreve
3 Pista: sig*i*i*a** o**e* 15 segundos y 25000 Puntos
[04:17] LibelulaBreve Tiempo! La respuesta es -> significant�ther <- [04:17] LibelulaBreve
Tiempo! La respuesta es -> significant�ther <-
[04:17] LibelulaBreve Tri.17450 CancionesɓTAMPID˿Dexquiennesolajcancionn"PORlARRIBA,lPORlABAJO"l?l [04:17] LibelulaBreve
Tri.17450 CancionesɓTAMPID˿Dexquiennesolajcancionn"PORlARRIBA,lPORlABAJO"l?l
[04:17] LibelulaBreve 1 Pista: ***** ****** Pregunta de BONUS : 50000 Puntos [04:17] LibelulaBreve
1 Pista: ***** ****** Pregunta de BONUS : 50000 Puntos
[04:17] LibelulaBreve 2 Pista: ric** ****** 30 segundos y 50000 Puntos [04:17] LibelulaBreve
2 Pista: ric** ****** 30 segundos y 50000 Puntos
[04:18] LibelulaBreve 3 Pista: ric** *a**i* 15 segundos y 50000 Puntos [04:18] LibelulaBreve
3 Pista: ric** *a**i* 15 segundos y 50000 Puntos
[04:18] LibelulaBreve Tiempo! La respuesta es -> ricky�artin <- [04:18] LibelulaBreve
Tiempo! La respuesta es -> ricky�artin <-
[04:18] LibelulaBreve Tri.1074 Idiomasɴjmm.com˿Acentogt�cogdelkfranc鳺...𮮮zelksombreritog?z [04:18] LibelulaBreve
Tri.1074 Idiomasɴjmm.com˿Acentogt�cogdelkfranc鳺...𮮮zelksombreritog?z
[04:18] LibelulaBreve 1 Pista: *********** Valor pregunta : 15095 Puntos [04:18] LibelulaBreve
1 Pista: *********** Valor pregunta : 15095 Puntos
[04:18] LibelulaBreve 2 Pista: Cir******** 30 segundos y 15095 Puntos [04:18] LibelulaBreve
2 Pista: Cir******** 30 segundos y 15095 Puntos
[04:19] LibelulaBreve 3 Pista: Cir*u***e*o 15 segundos y 15095 Puntos [04:19] LibelulaBreve
3 Pista: Cir*u***e*o 15 segundos y 15095 Puntos
[04:19] LibelulaBreve Tiempo! La respuesta es -> Circunflejo <- [04:19] LibelulaBreve
Tiempo! La respuesta es -> Circunflejo <-
[04:19] LibelulaBreve Please remember this is a FREE service, Please do not complain [04:19] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[04:19] LibelulaBreve Tri.9025 Historiaɴamzarian˿Aqqui鮃01isekacus󃰱qdekorganizarhlaprevoluci󮃰1idekBarcelonapdek1909?q(s󬯃01vapellidos)q?q [04:19] LibelulaBreve
Tri.9025 Historiaɴamzarian˿Aqqui鮃01isekacus󃰱qdekorganizarhlaprevoluci󮃰1idekBarcelonapdek1909?q(s󬯃01vapellidos)q?q
[04:19] LibelulaBreve 1 Pista: ****** ******* Valor pregunta : 15473 Puntos [04:19] LibelulaBreve
1 Pista: ****** ******* Valor pregunta : 15473 Puntos
[04:19] LibelulaBreve 2 Pista: fer*** ******* 30 segundos y 15473 Puntos [04:19] LibelulaBreve
2 Pista: fer*** ******* 30 segundos y 15473 Puntos
[04:19] LibelulaBreve 3 Pista: fer*e* *ua**ia 15 segundos y 15473 Puntos [04:19] LibelulaBreve
3 Pista: fer*e* *ua**ia 15 segundos y 15473 Puntos
[04:20] LibelulaBreve Tiempo! La respuesta es -> ferrer�uardia <- [04:20] LibelulaBreve
Tiempo! La respuesta es -> ferrer�uardia <-
[04:20] LibelulaBreve R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663 [04:20] LibelulaBreve
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663
[04:20] LibelulaBreve Tri.1876 MiscelaneaɔeLaRaNhA˿Elyinfortunioaponedahpruebahahloshamigoshyidescubre...a?a [04:20] LibelulaBreve
Tri.1876 MiscelaneaɔeLaRaNhA˿Elyinfortunioaponedahpruebahahloshamigoshyidescubre...a?a
[04:20] LibelulaBreve 1 Pista: * *** ******** Valor pregunta : 11040 Puntos [04:20] LibelulaBreve
1 Pista: * *** ******** Valor pregunta : 11040 Puntos
[04:20] LibelulaBreve 2 Pista: a�** ******** 30 segundos y 11040 Puntos [04:20] LibelulaBreve
2 Pista: a�** ******** 30 segundos y 11040 Puntos
[04:20] LibelulaBreve 3 Pista: a�o* e*e*i*o* 15 segundos y 11040 Puntos [04:20] LibelulaBreve
3 Pista: a�o* e*e*i*o* 15 segundos y 11040 Puntos
[04:21] LibelulaBreve Tiempo! La respuesta es -> a�os�nemigos <- [04:21] LibelulaBreve
Tiempo! La respuesta es -> a�os�nemigos <-
[04:21] LibelulaBreve If you think a Q&A is wrong, please call an OP [04:21] LibelulaBreve
If you think a Q&A is wrong, please call an OP
[04:21] LibelulaBreve Tri.15673 Miscelaneaɓebosin˿(Religi󮩃󭯃01csekllamauelrt�coctemplocjapon鳿j?j [04:21] LibelulaBreve
Tri.15673 Miscelaneaɓebosin˿(Religi󮩃󭯃01csekllamauelrt�coctemplocjapon鳿j?j
[04:21] LibelulaBreve 1 Pista: ****** Valor pregunta : 9501 Puntos [04:21] LibelulaBreve
1 Pista: ****** Valor pregunta : 9501 Puntos
[04:21] LibelulaBreve 2 Pista: pag*** 30 segundos y 9501 Puntos [04:21] LibelulaBreve
2 Pista: pag*** 30 segundos y 9501 Puntos
[04:21] LibelulaBreve 3 Pista: pago*a 15 segundos y 9501 Puntos [04:21] LibelulaBreve
3 Pista: pago*a 15 segundos y 9501 Puntos
[04:22] LibelulaBreve Tiempo! La respuesta es -> pagoda <- [04:22] LibelulaBreve
Tiempo! La respuesta es -> pagoda <-
[04:22] LibelulaBreve R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708 [04:22] LibelulaBreve
R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708
[04:22] LibelulaBreve Tri.17978 GeografiaɁcuarios˿ENlQUElCIUDADlSElENCUENTRAlLAlFAMOSAlPLAYAlDElLAlCONCHAl?l [04:22] LibelulaBreve
Tri.17978 GeografiaɁcuarios˿ENlQUElCIUDADlSElENCUENTRAlLAlFAMOSAlPLAYAlDElLAlCONCHAl?l
[04:22] LibelulaBreve 1 Pista: *** ********* Valor pregunta : 23909 Puntos [04:22] LibelulaBreve
1 Pista: *** ********* Valor pregunta : 23909 Puntos
[04:22] LibelulaBreve 2 Pista: san ********* 30 segundos y 23909 Puntos [04:22] LibelulaBreve
2 Pista: san ********* 30 segundos y 23909 Puntos
[04:22] LibelulaBreve 3 Pista: san *e*a**ia* 15 segundos y 23909 Puntos [04:22] LibelulaBreve
3 Pista: san *e*a**ia* 15 segundos y 23909 Puntos
[04:22] LibelulaBreve Tiempo! La respuesta es -> san�ebastian <- [04:22] LibelulaBreve
Tiempo! La respuesta es -> san�ebastian <-
[04:23] LibelulaBreve For The Competitive Edge type !pingme [04:23] LibelulaBreve
For The Competitive Edge type !pingme
[04:23] LibelulaBreve Tri.3758 DeporteɁcuarios˿ENdQUEdDEPORTEdHAYdUNdJUGADORdDENOMINADOdRAYEROd?d [04:23] LibelulaBreve
Tri.3758 DeporteɁcuarios˿ENdQUEdDEPORTEdHAYdUNdJUGADORdDENOMINADOdRAYEROd?d
[04:23] LibelulaBreve 1 Pista: ********* Pregunta de BONUS : 100000 Puntos [04:23] LibelulaBreve
1 Pista: ********* Pregunta de BONUS : 100000 Puntos
[04:23] LibelulaBreve 2 Pista: bal****** 30 segundos y 100000 Puntos [04:23] LibelulaBreve
2 Pista: bal****** 30 segundos y 100000 Puntos
[04:23] LibelulaBreve 3 Pista: balo**a*o 15 segundos y 100000 Puntos [04:23] LibelulaBreve
3 Pista: balo**a*o 15 segundos y 100000 Puntos
[04:23] LibelulaBreve Tiempo! La respuesta es -> balonmano <- [04:23] LibelulaBreve
Tiempo! La respuesta es -> balonmano <-
[04:24] LibelulaBreve Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [04:24] LibelulaBreve
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[04:24] LibelulaBreve Tri.17905 Cotilleo-TVɨupper˿COMOcEScCONOCIDAcLAcSERIEcSLIDERScENcESPA񁿃01c?c [04:24] LibelulaBreve
Tri.17905 Cotilleo-TVɨupper˿COMOcEScCONOCIDAcLAcSERIEcSLIDERScENcESPA񁿃01c?c
[04:24] LibelulaBreve 1 Pista: ***** ** ******** Valor pregunta : 12490 Puntos [04:24] LibelulaBreve
1 Pista: ***** ** ******** Valor pregunta : 12490 Puntos
[04:24] LibelulaBreve 2 Pista: sal** ** ******** 30 segundos y 12490 Puntos [04:24] LibelulaBreve
2 Pista: sal** ** ******** 30 segundos y 12490 Puntos
[04:24] LibelulaBreve 3 Pista: sal*o a* i**i*i*o 15 segundos y 12490 Puntos [04:24] LibelulaBreve
3 Pista: sal*o a* i**i*i*o 15 segundos y 12490 Puntos
[04:24] LibelulaBreve Tiempo! La respuesta es -> salto�l�nfinito <- [04:24] LibelulaBreve
Tiempo! La respuesta es -> salto�l�nfinito <-
[04:24] LibelulaBreve R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 8152451 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2841671 #8: Gata_Suave 1150014 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404 [04:24] LibelulaBreve
R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 8152451 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2841671 #8: Gata_Suave 1150014 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404
[04:24] LibelulaBreve Tri.16175 MiscelaneaɔeLaRaNhA˿Deudasqtengamosq?c [04:24] LibelulaBreve
Tri.16175 MiscelaneaɔeLaRaNhA˿Deudasqtengamosq?c
[04:24] LibelulaBreve 1 Pista: **** ****** ****** Pregunta de BONUS : 25000 Puntos [04:24] LibelulaBreve
1 Pista: **** ****** ****** Pregunta de BONUS : 25000 Puntos
[04:25] LibelulaBreve 2 Pista: per* ****** ****** 30 segundos y 25000 Puntos [04:25] LibelulaBreve
2 Pista: per* ****** ****** 30 segundos y 25000 Puntos
[04:25] LibelulaBreve 3 Pista: pero a*i*o* *ea*o* 15 segundos y 25000 Puntos [04:25] LibelulaBreve
3 Pista: pero a*i*o* *ea*o* 15 segundos y 25000 Puntos
[04:25] LibelulaBreve Tiempo! La respuesta es -> pero�migos�eamos <- [04:25] LibelulaBreve
Tiempo! La respuesta es -> pero�migos�eamos <-
[04:25] LibelulaBreve Please refrain from using Extreme Bad Language [04:25] LibelulaBreve
Please refrain from using Extreme Bad Language
[04:25] LibelulaBreve Tri.13321 GeografiaɅLCHUPAO˿ENbQUEbPROVINCIAbESPA񏌁bSEbENCUENTRAbALICATEb?b [04:25] LibelulaBreve
Tri.13321 GeografiaɅLCHUPAO˿ENbQUEbPROVINCIAbESPA񏌁bSEbENCUENTRAbALICATEb?b
[04:25] LibelulaBreve 1 Pista: ****** Valor pregunta : 17893 Puntos [04:25] LibelulaBreve
1 Pista: ****** Valor pregunta : 17893 Puntos
[04:26] LibelulaBreve 2 Pista: mal*** 30 segundos y 17893 Puntos [04:26] LibelulaBreve
2 Pista: mal*** 30 segundos y 17893 Puntos
[04:26] LibelulaBreve 3 Pista: mala*a 15 segundos y 17893 Puntos [04:26] LibelulaBreve
3 Pista: mala*a 15 segundos y 17893 Puntos
[04:26] Aguila}Torpe malaga [04:26] Aguila}Torpe
malaga
[04:26] LibelulaBreve �Increible!! Aguila}Torpe contest󺠃04"malaga" en �3.375 segundos, y ha ganado �7893�12 puntos [04:26] LibelulaBreve
�Increible!! Aguila}Torpe contest󺠃04"malaga" en �3.375 segundos, y ha ganado �7893�12 puntos
[04:26] LibelulaBreve Aguila}Torpe has acertado 11 seguidas!! Puntos HOY: 519260, SEMANA: 519260 y MES: 2859564 [04:26] LibelulaBreve
Aguila}Torpe has acertado 11 seguidas!! Puntos HOY: 519260, SEMANA: 519260 y MES: 2859564
[04:26] LibelulaBreve This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve [04:26] LibelulaBreve
This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve
[04:26] LibelulaBreve Tri.16134 DeporteɔDI˿ENsQUEsESTADIOsRECIBIOsJUANITOsUNsBOTELLAZOsENsLAsCABEZAsALsSERsSUSTITUIDOsENsUNsPARTIDOsCONsLAsSELECCIONs?s [04:26] LibelulaBreve
Tri.16134 DeporteɔDI˿ENsQUEsESTADIOsRECIBIOsJUANITOsUNsBOTELLAZOsENsLAsCABEZAsALsSERsSUSTITUIDOsENsUNsPARTIDOsCONsLAsSELECCIONs?s
[04:26] LibelulaBreve 1 Pista: *****񪠪******* ** ******** Valor pregunta : 17158 Puntos [04:26] LibelulaBreve
1 Pista: *****񪠪******* ** ******** Valor pregunta : 17158 Puntos
[04:26] LibelulaBreve 2 Pista: peq**񪠪******* ** ******** 30 segundos y 17158 Puntos [04:26] LibelulaBreve
2 Pista: peq**񪠪******* ** ******** 30 segundos y 17158 Puntos
[04:27] LibelulaBreve 3 Pista: peque񯠪a*a*a*a *e *e***a*o 15 segundos y 17158 Puntos [04:27] LibelulaBreve
3 Pista: peque񯠪a*a*a*a *e *e***a*o 15 segundos y 17158 Puntos
[04:27] LibelulaBreve Tiempo! La respuesta es -> peque񯠭aracana�e�elgrado <- [04:27] LibelulaBreve
Tiempo! La respuesta es -> peque񯠭aracana�e�elgrado <-
[04:27] Avestruz_Pedante ¡Buenas noches! [04:27] Avestruz_Pedante
¡Buenas noches!
[04:27] LibelulaBreve This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [04:27] LibelulaBreve
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[04:27] LibelulaBreve Tri.11584 Cineɂraco˿ACTORbPROTAGONISTAbDEb"COMObCONQUIsTARbHOLLYWOOD"b?b [04:27] LibelulaBreve
Tri.11584 Cineɂraco˿ACTORbPROTAGONISTAbDEb"COMObCONQUIsTARbHOLLYWOOD"b?b
[04:27] LibelulaBreve 1 Pista: **** ******** Valor pregunta : 14610 Puntos [04:27] LibelulaBreve
1 Pista: **** ******** Valor pregunta : 14610 Puntos
[04:27] LibelulaBreve 2 Pista: joh* ******** 30 segundos y 14610 Puntos [04:27] LibelulaBreve
2 Pista: joh* ******** 30 segundos y 14610 Puntos
[04:28] LibelulaBreve 3 Pista: joh* **a*o**a 15 segundos y 14610 Puntos [04:28] LibelulaBreve
3 Pista: joh* **a*o**a 15 segundos y 14610 Puntos
[04:28] LibelulaBreve Tiempo! La respuesta es -> john�ravolta <- [04:28] LibelulaBreve
Tiempo! La respuesta es -> john�ravolta <-
[04:28] LibelulaBreve Please remember this is a FREE service, Please do not complain [04:28] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[04:28] LibelulaBreve Tri.16388 Cotilleo-TVɓebosin˿Conpqu郰1sotronnombressesconoceselmcarm�s?s [04:28] LibelulaBreve
Tri.16388 Cotilleo-TVɓebosin˿Conpqu郰1sotronnombressesconoceselmcarm�s?s
[04:28] LibelulaBreve 1 Pista: *********** Valor pregunta : 10267 Puntos [04:28] LibelulaBreve
1 Pista: *********** Valor pregunta : 10267 Puntos
[04:28] Avestruz_Pedante Hola cristasol, buenas noches [04:28] Avestruz_Pedante
Hola cristasol, buenas noches
[04:28] LibelulaBreve 2 Pista: pin******** 30 segundos y 10267 Puntos [04:28] LibelulaBreve
2 Pista: pin******** 30 segundos y 10267 Puntos
[04:28] Avestruz_Pedante Hola Jirafa}Fugaz, bonita noche [04:28] Avestruz_Pedante
Hola Jirafa}Fugaz, bonita noche
[04:28] LibelulaBreve 3 Pista: pin*a*a*io* 15 segundos y 10267 Puntos [04:28] LibelulaBreve
3 Pista: pin*a*a*io* 15 segundos y 10267 Puntos
[04:29] LibelulaBreve Tiempo! La respuesta es -> pintalabios <- [04:29] LibelulaBreve
Tiempo! La respuesta es -> pintalabios <-
[04:29] Aguila}Torpe pintalabios [04:29] Aguila}Torpe
pintalabios
[04:29] LibelulaBreve This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 123071 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065 [04:29] LibelulaBreve
This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 123071 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065
[04:29] LibelulaBreve Tri.4865 HistoriaɦrederikˎombrexdexlalbatallaldondexAtilalfuexderrotadohporqunalcoalici󮃰1ndexpueblosrgermanosryzromal?r [04:29] LibelulaBreve
Tri.4865 HistoriaɦrederikˎombrexdexlalbatallaldondexAtilalfuexderrotadohporqunalcoalici󮃰1ndexpueblosrgermanosryzromal?r
[04:29] LibelulaBreve 1 Pista: ****** ************ Valor pregunta : 20688 Puntos [04:29] LibelulaBreve
1 Pista: ****** ************ Valor pregunta : 20688 Puntos
[04:29] LibelulaBreve 2 Pista: cam*** ************ 30 segundos y 20688 Puntos [04:29] LibelulaBreve
2 Pista: cam*** ************ 30 segundos y 20688 Puntos
[04:29] Avestruz_Pedante Saludos NN_vOx_Infierno-Fiscal [04:29] Avestruz_Pedante
Saludos NN_vOx_Infierno-Fiscal
[04:29] LibelulaBreve 3 Pista: cam*o* *a*a*au*i*o* 15 segundos y 20688 Puntos [04:29] LibelulaBreve
3 Pista: cam*o* *a*a*au*i*o* 15 segundos y 20688 Puntos
[04:30] LibelulaBreve Tiempo! La respuesta es -> campos�atalaunicos <- [04:30] LibelulaBreve
Tiempo! La respuesta es -> campos�atalaunicos <-
[04:30] LibelulaBreve R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 [04:30] LibelulaBreve
R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244
[04:30] LibelulaBreve Tri.9678 Musicaɚytox˿ComonsegllamaoelgdisconrecopilatorionquegpubliconlaoPepsig?b [04:30] LibelulaBreve
Tri.9678 Musicaɚytox˿ComonsegllamaoelgdisconrecopilatorionquegpubliconlaoPepsig?b
[04:30] LibelulaBreve 1 Pista: ********** **** Valor pregunta : 9914 Puntos [04:30] LibelulaBreve
1 Pista: ********** **** Valor pregunta : 9914 Puntos
[04:30] LibelulaBreve 2 Pista: gen******* **** 30 segundos y 9914 Puntos [04:30] LibelulaBreve
2 Pista: gen******* **** 30 segundos y 9914 Puntos
[04:30] LibelulaBreve 3 Pista: gene*a*io* *e** 15 segundos y 9914 Puntos [04:30] LibelulaBreve
3 Pista: gene*a*io* *e** 15 segundos y 9914 Puntos
[04:31] LibelulaBreve Tiempo! La respuesta es -> generation�ext <- [04:31] LibelulaBreve
Tiempo! La respuesta es -> generation�ext <-
[04:31] LibelulaBreve Top10 Players ( Weekly & Monthly ) are Auto-Voiced [04:31] LibelulaBreve
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[04:31] LibelulaBreve Tri.6711 ArteɂRUJI˿ENbLAb"FUENTEbDEbLOSbCUATRObRIOS"bQUEbRIOSbESTANbREPRESENTADOSb(ALFABETICAMENTE)"b?b [04:31] LibelulaBreve
Tri.6711 ArteɂRUJI˿ENbLAb"FUENTEbDEbLOSbCUATRObRIOS"bQUEbRIOSbESTANbREPRESENTADOSb(ALFABETICAMENTE)"b?b
[04:31] LibelulaBreve 1 Pista: ******* **** **** * *** ** ** ***** Valor pregunta : 9286 Puntos [04:31] LibelulaBreve
1 Pista: ******* **** **** * *** ** ** ***** Valor pregunta : 9286 Puntos
[04:31] LibelulaBreve 2 Pista: dan**** **** **** * *** ** ** ***** 30 segundos y 9286 Puntos [04:31] LibelulaBreve
2 Pista: dan**** **** **** * *** ** ** ***** 30 segundos y 9286 Puntos
[04:31] LibelulaBreve 3 Pista: danu*io i**o *i*o * *io *e *a **a*a 15 segundos y 9286 Puntos [04:31] LibelulaBreve
3 Pista: danu*io i**o *i*o * *io *e *a **a*a 15 segundos y 9286 Puntos
[04:31] LibelulaBreve Tiempo! La respuesta es -> danubio�ndo�ilo��io�e�a�lata <- [04:31] LibelulaBreve
Tiempo! La respuesta es -> danubio�ndo�ilo��io�e�a�lata <-
[04:32] LibelulaBreve Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [04:32] LibelulaBreve
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[04:32] LibelulaBreve Tri.19240 Eros-Sexɓhe_Devil˿C󭯃01bsevdicevenwgallegob"estarbempalmado"?a?a [04:32] LibelulaBreve
Tri.19240 Eros-Sexɓhe_Devil˿C󭯃01bsevdicevenwgallegob"estarbempalmado"?a?a
[04:32] LibelulaBreve 1 Pista: *** * ******* **** Valor pregunta : 10339 Puntos [04:32] LibelulaBreve
1 Pista: *** * ******* **** Valor pregunta : 10339 Puntos
[04:32] LibelulaBreve 2 Pista: ter * ******* **** 30 segundos y 10339 Puntos [04:32] LibelulaBreve
2 Pista: ter * ******* **** 30 segundos y 10339 Puntos
[04:32] LibelulaBreve 3 Pista: ter o *a*a**o *e*o 15 segundos y 10339 Puntos [04:32] LibelulaBreve
3 Pista: ter o *a*a**o *e*o 15 segundos y 10339 Puntos
[04:32] Aguila}Torpe ter a carallo teso [04:32] Aguila}Torpe
ter a carallo teso
[04:32] LibelulaBreve Tiempo! La respuesta es -> ter��arallo�eso <- [04:32] LibelulaBreve
Tiempo! La respuesta es -> ter��arallo�eso <-
[04:33] LibelulaBreve Tri.16278 LiteraturaɔeLaRaNhA˿Autorvdef"mefcasefconeunecomunista"g?g [04:33] LibelulaBreve
Tri.16278 LiteraturaɔeLaRaNhA˿Autorvdef"mefcasefconeunecomunista"g?g
[04:33] LibelulaBreve 1 Pista: ****** **** Valor pregunta : 18082 Puntos [04:33] LibelulaBreve
1 Pista: ****** **** Valor pregunta : 18082 Puntos
[04:33] LibelulaBreve 2 Pista: phi*** **** 30 segundos y 18082 Puntos [04:33] LibelulaBreve
2 Pista: phi*** **** 30 segundos y 18082 Puntos
[04:33] LibelulaBreve 3 Pista: phi*i* *o** 15 segundos y 18082 Puntos [04:33] LibelulaBreve
3 Pista: phi*i* *o** 15 segundos y 18082 Puntos
[04:33] LibelulaBreve Tiempo! La respuesta es -> philip�oth <- [04:33] LibelulaBreve
Tiempo! La respuesta es -> philip�oth <-
[04:33] LibelulaBreve We feature over 50,000 Q&A ! [04:33] LibelulaBreve
We feature over 50,000 Q&A !
[04:33] LibelulaBreve Tri.19409 Fisica-Quimicaɳica˿ComocseblebllamahahlahvitaminahB1mdesdebelhpuntocdebvistahquimicoc?m [04:33] LibelulaBreve
Tri.19409 Fisica-Quimicaɳica˿ComocseblebllamahahlahvitaminahB1mdesdebelhpuntocdebvistahquimicoc?m
[04:33] LibelulaBreve 1 Pista: ******* Valor pregunta : 16492 Puntos [04:33] LibelulaBreve
1 Pista: ******* Valor pregunta : 16492 Puntos
[04:34] LibelulaBreve 3 Pista: tia*i*a 15 segundos y 16492 Puntos [04:34] LibelulaBreve
3 Pista: tia*i*a 15 segundos y 16492 Puntos
[04:34] LibelulaBreve Tiempo! La respuesta es -> tiamina <- [04:34] LibelulaBreve
Tiempo! La respuesta es -> tiamina <-
[04:34] LibelulaBreve Tri.14664 DeporteɔDI˿CONTRAsquenEQUIPOsFRANCESsFUEsPRESENTADOsDIsSTEFANOsCOMOsNUEVOsJUGADORsDELsREALsMADRIDs?s [04:34] LibelulaBreve
Tri.14664 DeporteɔDI˿CONTRAsquenEQUIPOsFRANCESsFUEsPRESENTADOsDIsSTEFANOsCOMOsNUEVOsJUGADORsDELsREALsMADRIDs?s
[04:34] LibelulaBreve 1 Pista: ***** Valor pregunta : 5621 Puntos [04:34] LibelulaBreve
1 Pista: ***** Valor pregunta : 5621 Puntos
[04:35] LibelulaBreve 2 Pista: nan** 30 segundos y 5621 Puntos [04:35] LibelulaBreve
2 Pista: nan** 30 segundos y 5621 Puntos
[04:35] LibelulaBreve 3 Pista: nan** 15 segundos y 5621 Puntos [04:35] LibelulaBreve
3 Pista: nan** 15 segundos y 5621 Puntos
[04:35] LibelulaBreve Tiempo! La respuesta es -> nancy <- [04:35] LibelulaBreve
Tiempo! La respuesta es -> nancy <-
[04:35] LibelulaBreve Tri.12942 Medicina-Saludɬusie˅lfcuerpoehumano:pTieneneformahdevdiscoebic󮣡voeyksonetanepeque񯳃01iquevenecadahmil�troec�bicoehaykcuatroeahcincoemillones,pmidiendoeunasisietevmicrasidevdi᭥tro.pNoetienenen�cleo,pporzloequevsevconsideranec鬵lasimuertas� [04:35] LibelulaBreve
Tri.12942 Medicina-Saludɬusie˅lfcuerpoehumano:pTieneneformahdevdiscoebic󮣡voeyksonetanepeque񯳃01iquevenecadahmil�troec�bicoehaykcuatroeahcincoemillones,pmidiendoeunasisietevmicrasidevdi᭥tro.pNoetienenen�cleo,pporzloequevsevconsideranec鬵lasimuertas�
[04:35] LibelulaBreve 1 Pista: *** ******** ***** Valor pregunta : 11546 Puntos [04:35] LibelulaBreve
1 Pista: *** ******** ***** Valor pregunta : 11546 Puntos
[04:36] LibelulaBreve 2 Pista: los ******** ***** 30 segundos y 11546 Puntos [04:36] LibelulaBreve
2 Pista: los ******** ***** 30 segundos y 11546 Puntos
[04:36] LibelulaBreve 3 Pista: los **o*u*o* *o*o* 15 segundos y 11546 Puntos [04:36] LibelulaBreve
3 Pista: los **o*u*o* *o*o* 15 segundos y 11546 Puntos
[04:36] LibelulaBreve Tiempo! La respuesta es -> los�lobulos�ojos <- [04:36] LibelulaBreve
Tiempo! La respuesta es -> los�lobulos�ojos <-
[04:36] LibelulaBreve Please remember this is a FREE service, Please do not complain [04:36] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[04:36] LibelulaBreve Tri.6851 Cancionesɉngusetia˿DeaquieniesuelytemabBreakfastjatjtiffany'su?s [04:36] LibelulaBreve
Tri.6851 Cancionesɉngusetia˿DeaquieniesuelytemabBreakfastjatjtiffany'su?s
[04:36] LibelulaBreve 1 Pista: **** **** ********* Valor pregunta : 9374 Puntos [04:36] LibelulaBreve
1 Pista: **** **** ********* Valor pregunta : 9374 Puntos
[04:36] LibelulaBreve 2 Pista: dee* **** ********* 30 segundos y 9374 Puntos [04:36] LibelulaBreve
2 Pista: dee* **** ********* 30 segundos y 9374 Puntos
[04:37] LibelulaBreve 3 Pista: dee* **ue *o*e**i** 15 segundos y 9374 Puntos [04:37] LibelulaBreve
3 Pista: dee* **ue *o*e**i** 15 segundos y 9374 Puntos
[04:37] LibelulaBreve Tiempo! La respuesta es -> deep�lue�omething <- [04:37] LibelulaBreve
Tiempo! La respuesta es -> deep�lue�omething <-
[04:37] LibelulaBreve R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663 [04:37] LibelulaBreve
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663
[04:37] LibelulaBreve Tri.15894 Politicaɤassler˿C󭯃01fsecllamazlazAsambleazDemocrᴩcazquecesnreflejofdeclazvoluntadypol�cazdeclosnpa�sndeclazU.E.?g?g [04:37] LibelulaBreve
Tri.15894 Politicaɤassler˿C󭯃01fsecllamazlazAsambleazDemocrᴩcazquecesnreflejofdeclazvoluntadypol�cazdeclosnpa�sndeclazU.E.?g?g
[04:37] LibelulaBreve 1 Pista: ********** ******* Valor pregunta : 19956 Puntos [04:37] LibelulaBreve
1 Pista: ********** ******* Valor pregunta : 19956 Puntos
[04:37] LibelulaBreve 2 Pista: par******* ******* 30 segundos y 19956 Puntos [04:37] LibelulaBreve
2 Pista: par******* ******* 30 segundos y 19956 Puntos
[04:38] LibelulaBreve 3 Pista: par*a*e**o eu*o*eo 15 segundos y 19956 Puntos [04:38] LibelulaBreve
3 Pista: par*a*e**o eu*o*eo 15 segundos y 19956 Puntos
[04:38] LibelulaBreve Tiempo! La respuesta es -> parlamento�uropeo <- [04:38] LibelulaBreve
Tiempo! La respuesta es -> parlamento�uropeo <-
[04:38] LibelulaBreve If you think a Q&A is wrong, please call an OP [04:38] LibelulaBreve
If you think a Q&A is wrong, please call an OP
[04:38] LibelulaBreve Tri.15968 Idiomasɓebosin˿Diccionario-Prefijozquevsignificaf"dolencia"joz"afecci󮢿j?j [04:38] LibelulaBreve
Tri.15968 Idiomasɓebosin˿Diccionario-Prefijozquevsignificaf"dolencia"joz"afecci󮢿j?j
[04:38] LibelulaBreve 1 Pista: **** Valor pregunta : 17817 Puntos [04:38] LibelulaBreve
1 Pista: **** Valor pregunta : 17817 Puntos
[04:38] LibelulaBreve 2 Pista: pat* 30 segundos y 17817 Puntos [04:38] LibelulaBreve
2 Pista: pat* 30 segundos y 17817 Puntos
[04:39] LibelulaBreve 3 Pista: pato 15 segundos y 17817 Puntos [04:39] LibelulaBreve
3 Pista: pato 15 segundos y 17817 Puntos
[04:39] LibelulaBreve �Absolutamente correcto Aguila}Torpe!! Acertaste "pato" en �5.078 segundos y ganas �7817�12 puntos [04:39] LibelulaBreve
�Absolutamente correcto Aguila}Torpe!! Acertaste "pato" en �5.078 segundos y ganas �7817�12 puntos
[04:39] LibelulaBreve Aguila}Torpe has acertado 12 seguidas!! Puntos HOY: 537077, SEMANA: 537077 y MES: 2877381 [04:39] LibelulaBreve
Aguila}Torpe has acertado 12 seguidas!! Puntos HOY: 537077, SEMANA: 537077 y MES: 2877381
[04:39] Aguila}Torpe pato [04:39] Aguila}Torpe
pato
[04:39] LibelulaBreve R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708 [04:39] LibelulaBreve
R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708
[04:39] LibelulaBreve Tri.2273 MiscelaneaɎAPINE˿AaLAaLARGAaELaBUENaMANJAR,CANSAa?a [04:39] LibelulaBreve
Tri.2273 MiscelaneaɎAPINE˿AaLAaLARGAaELaBUENaMANJAR,CANSAa?a
[04:39] LibelulaBreve 1 Pista: ** *** ** ******* Pregunta de BONUS : 25000 Puntos [04:39] LibelulaBreve
1 Pista: ** *** ** ******* Pregunta de BONUS : 25000 Puntos
[04:39] LibelulaBreve 2 Pista: al�** ** ******* 30 segundos y 25000 Puntos [04:39] LibelulaBreve
2 Pista: al�** ** ******* 30 segundos y 25000 Puntos
[04:39] LibelulaBreve 3 Pista: al�i* e* *a*a*a* 15 segundos y 25000 Puntos [04:39] LibelulaBreve
3 Pista: al�i* e* *a*a*a* 15 segundos y 25000 Puntos
[04:40] LibelulaBreve Tiempo! La respuesta es -> al�in�l�aladar <- [04:40] LibelulaBreve
Tiempo! La respuesta es -> al�in�l�aladar <-
[04:40] LibelulaBreve For The Competitive Edge type !pingme [04:40] LibelulaBreve
For The Competitive Edge type !pingme
[04:40] LibelulaBreve Tri.3800 Deporteɨupper˿DONDErSErDISPUTARONrLOSrCAMPEONATOSrDELrMUNDOrDErNATACIONrDELr2003?r?r [04:40] LibelulaBreve
Tri.3800 Deporteɨupper˿DONDErSErDISPUTARONrLOSrCAMPEONATOSrDELrMUNDOrDErNATACIONrDELr2003?r?r
[04:40] LibelulaBreve 1 Pista: ********* Valor pregunta : 23757 Puntos [04:40] LibelulaBreve
1 Pista: ********* Valor pregunta : 23757 Puntos
[04:40] LibelulaBreve 2 Pista: bar****** 30 segundos y 23757 Puntos [04:40] LibelulaBreve
2 Pista: bar****** 30 segundos y 23757 Puntos
[04:40] Aguila}Torpe barcelona [04:40] Aguila}Torpe
barcelona
[04:40] LibelulaBreve �Ol頃04Aguila}Torpe!! Has contestado: "barcelona" en �1.14 segundos y sumas �3757�12 puntos a tu marcador. �Sigue as� [04:40] LibelulaBreve
�Ol頃04Aguila}Torpe!! Has contestado: "barcelona" en �1.14 segundos y sumas �3757�12 puntos a tu marcador. �Sigue as�
[04:40] LibelulaBreve Aguila}Torpe has acertado 13 seguidas!! Puntos HOY: 560834, SEMANA: 560834 y MES: 2901138 [04:40] LibelulaBreve
Aguila}Torpe has acertado 13 seguidas!! Puntos HOY: 560834, SEMANA: 560834 y MES: 2901138
[04:40] LibelulaBreve Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [04:40] LibelulaBreve
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[04:40] LibelulaBreve Tri.15839 Biologiaɂuzzati˿ENdQUEdUNICOdCASOdSEdPOSAdUNdVENCEJO?d?d [04:40] LibelulaBreve
Tri.15839 Biologiaɂuzzati˿ENdQUEdUNICOdCASOdSEdPOSAdUNdVENCEJO?d?d
[04:40] LibelulaBreve 1 Pista: **** ************ Valor pregunta : 21113 Puntos [04:40] LibelulaBreve
1 Pista: **** ************ Valor pregunta : 21113 Puntos
[04:41] LibelulaBreve 2 Pista: par* ************ 30 segundos y 21113 Puntos [04:41] LibelulaBreve
2 Pista: par* ************ 30 segundos y 21113 Puntos
[04:41] LibelulaBreve 3 Pista: para *e**o*u*i**e 15 segundos y 21113 Puntos [04:41] LibelulaBreve
3 Pista: para *e**o*u*i**e 15 segundos y 21113 Puntos
[04:41] LibelulaBreve Tiempo! La respuesta es -> para�eproducirse <- [04:41] LibelulaBreve
Tiempo! La respuesta es -> para�eproducirse <-
[04:41] LibelulaBreve R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 8152451 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2901138 #8: Gata_Suave 1150014 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404 [04:41] LibelulaBreve
R᮫ing MES: - #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 8152451 #4: Karen 5396065 #5: Alii 3905951 #6: Patito_Feo 3665227 #7: Aguila}Torpe 2901138 #8: Gata_Suave 1150014 #9: NN_vOx_Bukelizacion-YA 839312 #10: NN_vOx_Infierno-Fiscal 407404
[04:41] LibelulaBreve Tri.11306 DeporteɔeLaRaNhA˿GanadorjdehlamVueltamciclistamamEspa񡃰1m1999q?q [04:41] LibelulaBreve
Tri.11306 DeporteɔeLaRaNhA˿GanadorjdehlamVueltamciclistamamEspa񡃰1m1999q?q
[04:41] LibelulaBreve 1 Pista: *** ******* Pregunta de BONUS : 50000 Puntos [04:41] LibelulaBreve
1 Pista: *** ******* Pregunta de BONUS : 50000 Puntos
[04:41] LibelulaBreve 2 Pista: jan ******* 30 segundos y 50000 Puntos [04:41] LibelulaBreve
2 Pista: jan ******* 30 segundos y 50000 Puntos
[04:42] LibelulaBreve 3 Pista: jan u***i** 15 segundos y 50000 Puntos [04:42] LibelulaBreve
3 Pista: jan u***i** 15 segundos y 50000 Puntos
[04:42] LibelulaBreve Tiempo! La respuesta es -> jan�llrich <- [04:42] LibelulaBreve
Tiempo! La respuesta es -> jan�llrich <-
[04:42] Ardilla_Transparente Bienvenido elvigilante ADMIN de Radio Luna de Miel. [04:42] Ardilla_Transparente
Bienvenido elvigilante ADMIN de Radio Luna de Miel.
[04:42] LibelulaBreve Please refrain from using Extreme Bad Language [04:42] LibelulaBreve
Please refrain from using Extreme Bad Language
[04:42] LibelulaBreve Tri.17869 Gastronomiaɓort˿DEnDONDEnSONnTIPICASnLASnPERRUNILLASn?n [04:42] LibelulaBreve
Tri.17869 Gastronomiaɓort˿DEnDONDEnSONnTIPICASnLASnPERRUNILLASn?n
[04:42] LibelulaBreve 1 Pista: ********* Valor pregunta : 22870 Puntos [04:42] LibelulaBreve
1 Pista: ********* Valor pregunta : 22870 Puntos
[04:42] LibelulaBreve 2 Pista: sal****** 30 segundos y 22870 Puntos [04:42] LibelulaBreve
2 Pista: sal****** 30 segundos y 22870 Puntos
[04:43] LibelulaBreve 3 Pista: sala*a**a 15 segundos y 22870 Puntos [04:43] LibelulaBreve
3 Pista: sala*a**a 15 segundos y 22870 Puntos
[04:43] LibelulaBreve Tiempo! La respuesta es -> salamanca <- [04:43] LibelulaBreve
Tiempo! La respuesta es -> salamanca <-
[04:43] LibelulaBreve This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve [04:43] LibelulaBreve
This is #Mexico, I am your host LibelulaBreve, running LibelulaBreve
[04:43] LibelulaBreve Tri.11724 LiteraturaɍARdeJAVAˑUɃ01sAUTORs(1498?-1542)sESCRIBIӃ01s"HEROsYsLEANDRO".s(POEMAsSOBREsLAsF�ULAsDEsESTOSsAMANTESsSEGڎsMUSEO)s?s [04:43] LibelulaBreve
Tri.11724 LiteraturaɍARdeJAVAˑUɃ01sAUTORs(1498?-1542)sESCRIBIӃ01s"HEROsYsLEANDRO".s(POEMAsSOBREsLAsF�ULAsDEsESTOSsAMANTESsSEGڎsMUSEO)s?s
[04:43] LibelulaBreve 1 Pista: **** ****** Valor pregunta : 21079 Puntos [04:43] LibelulaBreve
1 Pista: **** ****** Valor pregunta : 21079 Puntos
[04:43] LibelulaBreve 2 Pista: jua* ****** 30 segundos y 21079 Puntos [04:43] LibelulaBreve
2 Pista: jua* ****** 30 segundos y 21079 Puntos
[04:44] LibelulaBreve 3 Pista: jua* *o**a* 15 segundos y 21079 Puntos [04:44] LibelulaBreve
3 Pista: jua* *o**a* 15 segundos y 21079 Puntos
[04:44] LibelulaBreve Tiempo! La respuesta es -> juan�oscan <- [04:44] LibelulaBreve
Tiempo! La respuesta es -> juan�oscan <-
[04:44] LibelulaBreve This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0 [04:44] LibelulaBreve
This WEEKS Top 11-20: - #11: * 0 #12: * 0 #13: * 0 #14: * 0 #15: * 0 #16: * 0 #17: * 0 #18: * 0 #19: * 0 #20: * 0
[04:44] LibelulaBreve Tri.8907 LiteraturaɂRUJI˿AMBIENTEqRELACIONADOqALqTEATROq?q [04:44] LibelulaBreve
Tri.8907 LiteraturaɂRUJI˿AMBIENTEqRELACIONADOqALqTEATROq?q
[04:44] LibelulaBreve 1 Pista: ********* Valor pregunta : 19089 Puntos [04:44] LibelulaBreve
1 Pista: ********* Valor pregunta : 19089 Puntos
[04:44] LibelulaBreve 2 Pista: far****** 30 segundos y 19089 Puntos [04:44] LibelulaBreve
2 Pista: far****** 30 segundos y 19089 Puntos
[04:44] LibelulaBreve 3 Pista: fara**u*a 15 segundos y 19089 Puntos [04:44] LibelulaBreve
3 Pista: fara**u*a 15 segundos y 19089 Puntos
[04:45] LibelulaBreve Tiempo! La respuesta es -> farandula <- [04:45] LibelulaBreve
Tiempo! La respuesta es -> farandula <-
[04:45] LibelulaBreve Please remember this is a FREE service, Please do not complain [04:45] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[04:45] LibelulaBreve Tri.8076 Idiomasɦlipp_er˿Comorseadicea"once"denlaleman?d?d [04:45] LibelulaBreve
Tri.8076 Idiomasɦlipp_er˿Comorseadicea"once"denlaleman?d?d
[04:45] LibelulaBreve 1 Pista: *** Pregunta de BONUS : 25000 Puntos [04:45] LibelulaBreve
1 Pista: *** Pregunta de BONUS : 25000 Puntos
[04:45] LibelulaBreve 2 Pista: elf 30 segundos y 25000 Puntos [04:45] LibelulaBreve
2 Pista: elf 30 segundos y 25000 Puntos
[04:45] Aguila}Torpe elf [04:45] Aguila}Torpe
elf
[04:45] LibelulaBreve �Eso es Aguila}Torpe!! Dijiste: "elf" y ello te ha valido: �5000�12 puntos [04:45] LibelulaBreve
�Eso es Aguila}Torpe!! Dijiste: "elf" y ello te ha valido: �5000�12 puntos
[04:45] LibelulaBreve Aguila}Torpe has acertado 14 seguidas!! Puntos HOY: 585834, SEMANA: 585834 y MES: 2926138 [04:45] LibelulaBreve
Aguila}Torpe has acertado 14 seguidas!! Puntos HOY: 585834, SEMANA: 585834 y MES: 2926138
[04:45] LibelulaBreve This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 123071 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065 [04:45] LibelulaBreve
This MONTHS Top 11-20: - #11: kitana_- 299678 #12: Guerrero08 297002 #13: KaZuMa_KiRyU 258500 #14: apolomx 201118 #15: Sirena__ 184577 #16: Aliiiiiiiiiiiii 181951 #17: David_Copperfield 157398 #18: Murcielago}Letal 123071 #19: AlbertoA 53703 #20: dsvsdvsdnv 46065
[04:45] LibelulaBreve Tri.1499 LiteraturaɎefthis˿AbquercorrienterperteneciaiAntonioqMachadoq?b [04:45] LibelulaBreve
Tri.1499 LiteraturaɎefthis˿AbquercorrienterperteneciaiAntonioqMachadoq?b
[04:45] LibelulaBreve 1 Pista: ********** Valor pregunta : 5239 Puntos [04:45] LibelulaBreve
1 Pista: ********** Valor pregunta : 5239 Puntos
[04:46] LibelulaBreve 2 Pista: Mod******* 30 segundos y 5239 Puntos [04:46] LibelulaBreve
2 Pista: Mod******* 30 segundos y 5239 Puntos
[04:46] LibelulaBreve 3 Pista: Mode**i**o 15 segundos y 5239 Puntos [04:46] LibelulaBreve
3 Pista: Mode**i**o 15 segundos y 5239 Puntos
[04:46] LibelulaBreve Tiempo! La respuesta es -> Modernismo <- [04:46] LibelulaBreve
Tiempo! La respuesta es -> Modernismo <-
[04:46] LibelulaBreve R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244 [04:46] LibelulaBreve
R᮫ing �ltima SEMANA: #1: welcome3 21169436 #2: Danielitto 9461774 #3: HormigaPedante 7226244
[04:46] LibelulaBreve Tri.20160 DeporteɁlkaid˿JUDO:COMOeSEeDENOMINAeLAeCAIDAeHACEeATRAS?e?e [04:46] LibelulaBreve
Tri.20160 DeporteɁlkaid˿JUDO:COMOeSEeDENOMINAeLAeCAIDAeHACEeATRAS?e?e
[04:46] LibelulaBreve 1 Pista: ****** ***** Valor pregunta : 12037 Puntos [04:46] LibelulaBreve
1 Pista: ****** ***** Valor pregunta : 12037 Puntos
[04:47] LibelulaBreve 2 Pista: ush*** ***** 30 segundos y 12037 Puntos [04:47] LibelulaBreve
2 Pista: ush*** ***** 30 segundos y 12037 Puntos
[04:47] LibelulaBreve 3 Pista: ushi*o u*e*i 15 segundos y 12037 Puntos [04:47] LibelulaBreve
3 Pista: ushi*o u*e*i 15 segundos y 12037 Puntos
[04:47] LibelulaBreve Tiempo! La respuesta es -> ushiro�kemi <- [04:47] LibelulaBreve
Tiempo! La respuesta es -> ushiro�kemi <-
[04:47] LibelulaBreve Top10 Players ( Weekly & Monthly ) are Auto-Voiced [04:47] LibelulaBreve
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[04:47] LibelulaBreve Tri.3799 Arteɓibila˿DONDEhESTAhLAhFUNDACIONhMIROh?h [04:47] LibelulaBreve
Tri.3799 Arteɓibila˿DONDEhESTAhLAhFUNDACIONhMIROh?h
[04:47] LibelulaBreve 1 Pista: ********* Valor pregunta : 7044 Puntos [04:47] LibelulaBreve
1 Pista: ********* Valor pregunta : 7044 Puntos
[04:47] LibelulaBreve 2 Pista: bar****** 30 segundos y 7044 Puntos [04:47] LibelulaBreve
2 Pista: bar****** 30 segundos y 7044 Puntos
[04:48] LibelulaBreve 3 Pista: bar*e*o*a 15 segundos y 7044 Puntos [04:48] LibelulaBreve
3 Pista: bar*e*o*a 15 segundos y 7044 Puntos
[04:48] LibelulaBreve Tiempo! La respuesta es -> barcelona <- [04:48] LibelulaBreve
Tiempo! La respuesta es -> barcelona <-
[04:48] LibelulaBreve Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [04:48] LibelulaBreve
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[04:48] LibelulaBreve Tri.20132 Cancionesɰailas˿EnjquedalbumededR.E.M.esedencuentraglagcancionj"Lotus"e?e [04:48] LibelulaBreve
Tri.20132 Cancionesɰailas˿EnjquedalbumededR.E.M.esedencuentraglagcancionj"Lotus"e?e
[04:48] LibelulaBreve 1 Pista: ** Valor pregunta : 15066 Puntos [04:48] LibelulaBreve
1 Pista: ** Valor pregunta : 15066 Puntos
[04:48] LibelulaBreve 2 Pista: up 30 segundos y 15066 Puntos [04:48] LibelulaBreve
2 Pista: up 30 segundos y 15066 Puntos
[04:49] LibelulaBreve 3 Pista: up 15 segundos y 15066 Puntos [04:49] LibelulaBreve
3 Pista: up 15 segundos y 15066 Puntos
[04:49] LibelulaBreve Tiempo! La respuesta es -> up <- [04:49] LibelulaBreve
Tiempo! La respuesta es -> up <-
[04:49] LibelulaBreve Tri.20068 Cotilleo-TVɃarPEnTer˿(LoskSimpson-5ʃ01qtemporada)qQu郰1qregalod(robado)qleidavHomerravBartnenieldepisodiod"Exploradorrdeiinc󧮩to"q?q [04:49] LibelulaBreve
Tri.20068 Cotilleo-TVɃarPEnTer˿(LoskSimpson-5ʃ01qtemporada)qQu郰1qregalod(robado)qleidavHomerravBartnenieldepisodiod"Exploradorrdeiinc󧮩to"q?q
[04:49] LibelulaBreve 1 Pista: *** ****** ********* Valor pregunta : 14868 Puntos [04:49] LibelulaBreve
1 Pista: *** ****** ********* Valor pregunta : 14868 Puntos
[04:49] LibelulaBreve 2 Pista: una ****** ********* 30 segundos y 14868 Puntos [04:49] LibelulaBreve
2 Pista: una ****** ********* 30 segundos y 14868 Puntos
[04:50] LibelulaBreve 3 Pista: una *a*a*a *u**iu*o* 15 segundos y 14868 Puntos [04:50] LibelulaBreve
3 Pista: una *a*a*a *u**iu*o* 15 segundos y 14868 Puntos
[04:50] LibelulaBreve Tiempo! La respuesta es -> una�avaja�ultiusos <- [04:50] LibelulaBreve
Tiempo! La respuesta es -> una�avaja�ultiusos <-
[04:50] LibelulaBreve We feature over 50,000 Q&A ! [04:50] LibelulaBreve
We feature over 50,000 Q&A !
[04:50] LibelulaBreve Tri.1518 Informaticaɴjmm.com˿C󭯃01osexllamameltsistemamdexficherosqpropioodexWindowsq2000?o?o [04:50] LibelulaBreve
Tri.1518 Informaticaɴjmm.com˿C󭯃01osexllamameltsistemamdexficherosqpropioodexWindowsq2000?o?o
[04:50] LibelulaBreve 1 Pista: **** * Valor pregunta : 23323 Puntos [04:50] LibelulaBreve
1 Pista: **** * Valor pregunta : 23323 Puntos
[04:50] LibelulaBreve 2 Pista: NTF* * 30 segundos y 23323 Puntos [04:50] LibelulaBreve
2 Pista: NTF* * 30 segundos y 23323 Puntos
[04:51] LibelulaBreve 3 Pista: NTF* * 15 segundos y 23323 Puntos [04:51] LibelulaBreve
3 Pista: NTF* * 15 segundos y 23323 Puntos
[04:51] LibelulaBreve Tiempo! La respuesta es -> NTFS� <- [04:51] LibelulaBreve
Tiempo! La respuesta es -> NTFS� <-
[04:51] LibelulaBreve Tri.5945 GastronomiaɎaTa˿ENkQUEkCIUDADkTIENEkSUkORIGENkELkBRANDYk?k [04:51] LibelulaBreve
Tri.5945 GastronomiaɎaTa˿ENkQUEkCIUDADkTIENEkSUkORIGENkELkBRANDYk?k
[04:51] LibelulaBreve 1 Pista: ****** Valor pregunta : 7719 Puntos [04:51] LibelulaBreve
1 Pista: ****** Valor pregunta : 7719 Puntos
[04:51] LibelulaBreve 2 Pista: cog*** 30 segundos y 7719 Puntos [04:51] LibelulaBreve
2 Pista: cog*** 30 segundos y 7719 Puntos
[04:51] LibelulaBreve 3 Pista: cog*a* 15 segundos y 7719 Puntos [04:51] LibelulaBreve
3 Pista: cog*a* 15 segundos y 7719 Puntos
[04:52] LibelulaBreve Tiempo! La respuesta es -> cognac <- [04:52] LibelulaBreve
Tiempo! La respuesta es -> cognac <-
[04:52] LibelulaBreve Tri.4864 Geografiaɂatval˿AVIACION-NOMBREaDELaAEROPUERTOaDEaAJACCIOa?a [04:52] LibelulaBreve
Tri.4864 Geografiaɂatval˿AVIACION-NOMBREaDELaAEROPUERTOaDEaAJACCIOa?a
[04:52] LibelulaBreve 1 Pista: ***** ****'*** Valor pregunta : 23814 Puntos [04:52] LibelulaBreve
1 Pista: ***** ****'*** Valor pregunta : 23814 Puntos
[04:52] LibelulaBreve 2 Pista: cam** ****'*** 30 segundos y 23814 Puntos [04:52] LibelulaBreve
2 Pista: cam** ****'*** 30 segundos y 23814 Puntos
[04:52] LibelulaBreve 3 Pista: cam*o *e**'o*o 15 segundos y 23814 Puntos [04:52] LibelulaBreve
3 Pista: cam*o *e**'o*o 15 segundos y 23814 Puntos
[04:53] LibelulaBreve Tiempo! La respuesta es -> campo�ell'oro <- [04:53] LibelulaBreve
Tiempo! La respuesta es -> campo�ell'oro <-
[04:53] LibelulaBreve Please remember this is a FREE service, Please do not complain [04:53] LibelulaBreve
Please remember this is a FREE service, Please do not complain
[04:53] LibelulaBreve Tri.3028 LiteraturaɔeLaRaNhA˿Autorhdeg"untso񡤯rhparayuntpueblo"j?j [04:53] LibelulaBreve
Tri.3028 LiteraturaɔeLaRaNhA˿Autorhdeg"untso񡤯rhparayuntpueblo"j?j
[04:53] LibelulaBreve 1 Pista: ******* ***** ******* Pregunta de BONUS : 100000 Puntos [04:53] LibelulaBreve
1 Pista: ******* ***** ******* Pregunta de BONUS : 100000 Puntos
[04:53] LibelulaBreve 2 Pista: ant**** ***** ******* 30 segundos y 100000 Puntos [04:53] LibelulaBreve
2 Pista: ant**** ***** ******* 30 segundos y 100000 Puntos
[04:53] LibelulaBreve 3 Pista: anto*io *ue*o *a**e*o 15 segundos y 100000 Puntos [04:53] LibelulaBreve
3 Pista: anto*io *ue*o *a**e*o 15 segundos y 100000 Puntos
[04:54] LibelulaBreve Tiempo! La respuesta es -> antonio�uero�allejo <- [04:54] LibelulaBreve
Tiempo! La respuesta es -> antonio�uero�allejo <-
[04:54] LibelulaBreve R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663 [04:54] LibelulaBreve
R᮫ing �ltimo MES: #1: welcome3 47184374 #2: Danielitto 39874076 #3: Aguila}Torpe 30927547 #4: Patito_Feo 16843241 #5: Karen 14172663
[04:54] LibelulaBreve Tri.4011 DeporteɄUBLINERS˿ElomashfamosoddektodoshloshatletashdekSeulo88tfue............t?t [04:54] LibelulaBreve
Tri.4011 DeporteɄUBLINERS˿ElomashfamosoddektodoshloshatletashdekSeulo88tfue............t?t
[04:54] LibelulaBreve 1 Pista: *** ******* Valor pregunta : 23852 Puntos [04:54] LibelulaBreve
1 Pista: *** ******* Valor pregunta : 23852 Puntos
[04:54] LibelulaBreve 2 Pista: ben ******* 30 segundos y 23852 Puntos [04:54] LibelulaBreve
2 Pista: ben ******* 30 segundos y 23852 Puntos
[04:54] LibelulaBreve 3 Pista: ben *o***o* 15 segundos y 23852 Puntos [04:54] LibelulaBreve
3 Pista: ben *o***o* 15 segundos y 23852 Puntos
[04:54] LibelulaBreve Tiempo! La respuesta es -> ben�ohnson <- [04:54] LibelulaBreve
Tiempo! La respuesta es -> ben�ohnson <-
[04:55] LibelulaBreve If you think a Q&A is wrong, please call an OP [04:55] LibelulaBreve
If you think a Q&A is wrong, please call an OP
[04:55] LibelulaBreve Tri.14083 CineɅLCHUPAO˿COMOlSElLLAMAlELlPERSONAJElDElUMAlTHURMANlENlPULPlFICTIONl?l [04:55] LibelulaBreve
Tri.14083 CineɅLCHUPAO˿COMOlSElLLAMAlELlPERSONAJElDElUMAlTHURMANlENlPULPlFICTIONl?l
[04:55] LibelulaBreve 1 Pista: *** ******* Valor pregunta : 12115 Puntos [04:55] LibelulaBreve
1 Pista: *** ******* Valor pregunta : 12115 Puntos
[04:55] LibelulaBreve 2 Pista: mia ******* 30 segundos y 12115 Puntos [04:55] LibelulaBreve
2 Pista: mia ******* 30 segundos y 12115 Puntos
[04:55] LibelulaBreve 3 Pista: mia *a**a*e 15 segundos y 12115 Puntos [04:55] LibelulaBreve
3 Pista: mia *a**a*e 15 segundos y 12115 Puntos
[04:55] LibelulaBreve Tiempo! La respuesta es -> mia�allace <- [04:55] LibelulaBreve
Tiempo! La respuesta es -> mia�allace <-
[04:56] LibelulaBreve R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708 [04:56] LibelulaBreve
R᮫ing por D́: - Domingo: welcome3 2724609 Lunes: welcome3 1494669 Martes: welcome3 3026421 Miercoles: welcome3 3747819 Jueves: welcome3 1233849 Viernes: welcome3 5655361 Sᢡdo: welcome3 3286708
[04:56] LibelulaBreve Tri.15157 GeografiaɍARdeJAVA˿ENdQUɃ01dESTADOdNORTEAMERICANOdSEdHALLAdLAdCIUDADdDEdROME?d?d [04:56] LibelulaBreve
Tri.15157 GeografiaɍARdeJAVA˿ENdQUɃ01dESTADOdNORTEAMERICANOdSEdHALLAdLAdCIUDADdDEdROME?d?d
[04:56] LibelulaBreve 1 Pista: ***** **** Valor pregunta : 13764 Puntos [04:56] LibelulaBreve
1 Pista: ***** **** Valor pregunta : 13764 Puntos
[04:56] LibelulaBreve 2 Pista: nue** **** 30 segundos y 13764 Puntos [04:56] LibelulaBreve
2 Pista: nue** **** 30 segundos y 13764 Puntos
[04:56] LibelulaBreve 3 Pista: nue*a *o** 15 segundos y 13764 Puntos [04:56] LibelulaBreve
3 Pista: nue*a *o** 15 segundos y 13764 Puntos
[04:56] LibelulaBreve Tiempo! La respuesta es -> nueva�ork <- [04:56] LibelulaBreve
Tiempo! La respuesta es -> nueva�ork <-
[04:56] LibelulaBreve Trivial AUTO Parado. Para reiniciar el Trivial escriba !jugar [04:56] LibelulaBreve
Trivial AUTO Parado. Para reiniciar el Trivial escriba !jugar
Reportar Volver Historia anterior Historia siguiente
1
| Compartir en: