Historia de #mexico 10/01/2026 00:53 54 visitas

Hour Alias Mensaje Mensaje
[00:53] Cocodrilo-ConPrisa !jugar [00:53] Cocodrilo-ConPrisa
!jugar
[00:53] Libelula\SinRespeto EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!! [00:53] Libelula\SinRespeto
EL TRIVIAL EMPIEZA EN 10 SEGUNDOS,PREPARADOS!!!
[00:53] Libelula\SinRespeto R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0 [00:53] Libelula\SinRespeto
R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0
[00:53] Libelula\SinRespeto Tri.6777 LiteraturaɍARdeJAVA˿"LAfTABLA..."fDEfQUɃ01fREGIӎfEUROPEAfPODEMOSfLEERfENfELfT͔ULOfDEfUNAfCONOCIDAfNOVELAfDEfARTUROfPɒEZfREVERTEfQUEfTRATAfSOBREfUNfMISTERIOfRELACIONADOfCONfUNAfPARTIDAfDEfAJEDREZ?f?f [00:53] Libelula\SinRespeto
Tri.6777 LiteraturaɍARdeJAVA˿"LAfTABLA..."fDEfQUɃ01fREGIӎfEUROPEAfPODEMOSfLEERfENfELfT͔ULOfDEfUNAfCONOCIDAfNOVELAfDEfARTUROfPɒEZfREVERTEfQUEfTRATAfSOBREfUNfMISTERIOfRELACIONADOfCONfUNAfPARTIDAfDEfAJEDREZ?f?f
[00:53] Libelula\SinRespeto 1 Pista: ** ******* Valor pregunta : 17755 Puntos [00:53] Libelula\SinRespeto
1 Pista: ** ******* Valor pregunta : 17755 Puntos
[00:53] Libelula\SinRespeto 2 Pista: de�****** 30 segundos y 17755 Puntos [00:53] Libelula\SinRespeto
2 Pista: de�****** 30 segundos y 17755 Puntos
[00:54] Libelula\SinRespeto 3 Pista: de�*a**e* 15 segundos y 17755 Puntos [00:54] Libelula\SinRespeto
3 Pista: de�*a**e* 15 segundos y 17755 Puntos
[00:54] Libelula\SinRespeto Tiempo! La respuesta es -> de�landes <- [00:54] Libelula\SinRespeto
Tiempo! La respuesta es -> de�landes <-
[00:54] Libelula\SinRespeto Nuevo D́,todos a cero!! [00:54] Libelula\SinRespeto
Nuevo D́,todos a cero!!
[00:54] Libelula\SinRespeto Top10 Players ( Weekly & Monthly ) are Auto-Voiced [00:54] Libelula\SinRespeto
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[00:54] Libelula\SinRespeto Tri.9233 Arteɒolo˿AwquemsemdedicabaqTinaqModottil?w [00:54] Libelula\SinRespeto
Tri.9233 Arteɒolo˿AwquemsemdedicabaqTinaqModottil?w
[00:54] Libelula\SinRespeto 1 Pista: ********** Valor pregunta : 8421 Puntos [00:54] Libelula\SinRespeto
1 Pista: ********** Valor pregunta : 8421 Puntos
[00:54] Libelula\SinRespeto 2 Pista: fot******* 30 segundos y 8421 Puntos [00:54] Libelula\SinRespeto
2 Pista: fot******* 30 segundos y 8421 Puntos
[00:54] Cocodrilo-ConPrisa fotografia [00:54] Cocodrilo-ConPrisa
fotografia
[00:54] Libelula\SinRespeto �As�e hace Cocodrilo-ConPrisa!! Contestaste "fotografia" en �7.265 segundos y sumas �421�12 puntos [00:54] Libelula\SinRespeto
�As�e hace Cocodrilo-ConPrisa!! Contestaste "fotografia" en �7.265 segundos y sumas �421�12 puntos
[00:54] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 1 seguidas!! Puntos HOY: 8421, SEMANA: 13507398 y MES: 13507398 [00:54] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 1 seguidas!! Puntos HOY: 8421, SEMANA: 13507398 y MES: 13507398
[00:55] Libelula\SinRespeto Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [00:55] Libelula\SinRespeto
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[00:55] Libelula\SinRespeto Tri.5350 Mitologiaɲaziel9˿DEpQUEpCULTURApSONpTIPICOSpLOSpDOLMENES?p?p [00:55] Libelula\SinRespeto
Tri.5350 Mitologiaɲaziel9˿DEpQUEpCULTURApSONpTIPICOSpLOSpDOLMENES?p?p
[00:55] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 9145 Puntos [00:55] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 9145 Puntos
[00:55] Libelula\SinRespeto 2 Pista: cel*** 30 segundos y 9145 Puntos [00:55] Libelula\SinRespeto
2 Pista: cel*** 30 segundos y 9145 Puntos
[00:55] Cocodrilo-ConPrisa celta [00:55] Cocodrilo-ConPrisa
celta
[00:55] Libelula\SinRespeto 3 Pista: cel*a* 15 segundos y 9145 Puntos [00:55] Libelula\SinRespeto
3 Pista: cel*a* 15 segundos y 9145 Puntos
[00:55] Cocodrilo-ConPrisa celtas [00:55] Cocodrilo-ConPrisa
celtas
[00:55] Libelula\SinRespeto �emuestra lo que sabes Cocodrilo-ConPrisa! Has respondido "celtas" correctamente y eso te da: �145�12 puntos [00:55] Libelula\SinRespeto
�emuestra lo que sabes Cocodrilo-ConPrisa! Has respondido "celtas" correctamente y eso te da: �145�12 puntos
[00:55] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 2 seguidas!! Puntos HOY: 17566, SEMANA: 13516543 y MES: 13516543 [00:55] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 2 seguidas!! Puntos HOY: 17566, SEMANA: 13516543 y MES: 13516543
[00:55] Libelula\SinRespeto R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 17788999 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 13516543 #5: Culebra}Agil 10719074 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3404858 [00:55] Libelula\SinRespeto
R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 17788999 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 13516543 #5: Culebra}Agil 10719074 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3404858
[00:55] Libelula\SinRespeto Tri.16990 BiologiaɈdosO˿CUaLxESxELxCOMPONENTExPROTeICOxDExLASxUсSx?x [00:55] Libelula\SinRespeto
Tri.16990 BiologiaɈdosO˿CUaLxESxELxCOMPONENTExPROTeICOxDExLASxUсSx?x
[00:55] Libelula\SinRespeto 1 Pista: ********* Valor pregunta : 22593 Puntos [00:55] Libelula\SinRespeto
1 Pista: ********* Valor pregunta : 22593 Puntos
[00:56] Libelula\SinRespeto 2 Pista: que****** 30 segundos y 22593 Puntos [00:56] Libelula\SinRespeto
2 Pista: que****** 30 segundos y 22593 Puntos
[00:56] Cocodrilo-ConPrisa queratina [00:56] Cocodrilo-ConPrisa
queratina
[00:56] Libelula\SinRespeto �Bingo!! Cocodrilo-ConPrisa dio la respuesta: "queratina" en �0.079 segundos e incrementa sus ganancias con �2593�12 puntos [00:56] Libelula\SinRespeto
�Bingo!! Cocodrilo-ConPrisa dio la respuesta: "queratina" en �0.079 segundos e incrementa sus ganancias con �2593�12 puntos
[00:56] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 3 seguidas!! Puntos HOY: 40159, SEMANA: 13539136 y MES: 13539136 [00:56] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 3 seguidas!! Puntos HOY: 40159, SEMANA: 13539136 y MES: 13539136
[00:56] Libelula\SinRespeto We feature over 50,000 Q&A ! [00:56] Libelula\SinRespeto
We feature over 50,000 Q&A !
[00:56] Libelula\SinRespeto Tri.1768 Informaticaɤassler˿Cuᬃ01opuedecserfconsideradomcomomprimerfsoportecinformᴩco,wcreadomporfHollerith?w?w [00:56] Libelula\SinRespeto
Tri.1768 Informaticaɤassler˿Cuᬃ01opuedecserfconsideradomcomomprimerfsoportecinformᴩco,wcreadomporfHollerith?w?w
[00:56] Libelula\SinRespeto 1 Pista: ******** ********** Pregunta de BONUS : 200000 Puntos [00:56] Libelula\SinRespeto
1 Pista: ******** ********** Pregunta de BONUS : 200000 Puntos
[00:56] Libelula\SinRespeto 2 Pista: Tar***** ********** 30 segundos y 200000 Puntos [00:56] Libelula\SinRespeto
2 Pista: Tar***** ********** 30 segundos y 200000 Puntos
[00:56] Cocodrilo-ConPrisa tarjetas perforadas [00:56] Cocodrilo-ConPrisa
tarjetas perforadas
[00:56] Libelula\SinRespeto �As�e hace Cocodrilo-ConPrisa!! Contestaste "tarjetas perforadas" en �5.188 segundos y sumas �00000�12 puntos [00:56] Libelula\SinRespeto
�As�e hace Cocodrilo-ConPrisa!! Contestaste "tarjetas perforadas" en �5.188 segundos y sumas �00000�12 puntos
[00:56] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 4 seguidas!! Puntos HOY: 240159, SEMANA: 13739136 y MES: 13739136 [00:56] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 4 seguidas!! Puntos HOY: 240159, SEMANA: 13739136 y MES: 13739136
[00:57] Libelula\SinRespeto Tri.4685 MitologiaɅME^˿vCU�vESvELvSOBRENOMBREvDEvCERESvENvTEBASv?v?v [00:57] Libelula\SinRespeto
Tri.4685 MitologiaɅME^˿vCU�vESvELvSOBRENOMBREvDEvCERESvENvTEBASv?v?v
[00:57] Libelula\SinRespeto 1 Pista: ******* Valor pregunta : 24438 Puntos [00:57] Libelula\SinRespeto
1 Pista: ******* Valor pregunta : 24438 Puntos
[00:57] Libelula\SinRespeto 2 Pista: cab**** 30 segundos y 24438 Puntos [00:57] Libelula\SinRespeto
2 Pista: cab**** 30 segundos y 24438 Puntos
[00:57] Libelula\SinRespeto 3 Pista: cabi*ia 15 segundos y 24438 Puntos [00:57] Libelula\SinRespeto
3 Pista: cabi*ia 15 segundos y 24438 Puntos
[00:57] Cocodrilo-ConPrisa cebilia [00:57] Cocodrilo-ConPrisa
cebilia
[00:57] Cocodrilo-ConPrisa cebinia [00:57] Cocodrilo-ConPrisa
cebinia
[00:57] Libelula\SinRespeto Tiempo! La respuesta es -> cabiria <- [00:57] Libelula\SinRespeto
Tiempo! La respuesta es -> cabiria <-
[00:57] Libelula\SinRespeto Tri.7801 Medicina-Saludɖivian˿Elmepic󮤩loaesvungm�sculoaquejestჰ1ien...?i?i [00:57] Libelula\SinRespeto
Tri.7801 Medicina-Saludɖivian˿Elmepic󮤩loaesvungm�sculoaquejestჰ1ien...?i?i
[00:57] Libelula\SinRespeto 1 Pista: ** ***** Valor pregunta : 10605 Puntos [00:57] Libelula\SinRespeto
1 Pista: ** ***** Valor pregunta : 10605 Puntos
[00:58] Cocodrilo-ConPrisa el humero [00:58] Cocodrilo-ConPrisa
el humero
[00:58] Libelula\SinRespeto 2 Pista: el�**** 30 segundos y 10605 Puntos [00:58] Libelula\SinRespeto
2 Pista: el�**** 30 segundos y 10605 Puntos
[00:58] Cocodrilo-ConPrisa el frazo [00:58] Cocodrilo-ConPrisa
el frazo
[00:58] Libelula\SinRespeto 3 Pista: el�*a*o 15 segundos y 10605 Puntos [00:58] Libelula\SinRespeto
3 Pista: el�*a*o 15 segundos y 10605 Puntos
[00:58] Cocodrilo-ConPrisa el braso [00:58] Cocodrilo-ConPrisa
el braso
[00:58] Libelula\SinRespeto Tiempo! La respuesta es -> el�razo <- [00:58] Libelula\SinRespeto
Tiempo! La respuesta es -> el�razo <-
[00:58] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [00:58] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[00:58] Libelula\SinRespeto Tri.20168 Politicaɤassler˿C󭯃01aseullamayeluplanboadise񯃰1aparayunaysociedaddporkelucualuseufacilitanbtodosdlosdrecursosdqueuconsiganbelubienestarkparaytodosdsusdmiembros?f?f [00:58] Libelula\SinRespeto
Tri.20168 Politicaɤassler˿C󭯃01aseullamayeluplanboadise񯃰1aparayunaysociedaddporkelucualuseufacilitanbtodosdlosdrecursosdqueuconsiganbelubienestarkparaytodosdsusdmiembros?f?f
[00:58] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 17931 Puntos [00:58] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 17931 Puntos
[00:59] Cocodrilo-ConPrisa social [00:59] Cocodrilo-ConPrisa
social
[00:59] Libelula\SinRespeto 2 Pista: uto*** 30 segundos y 17931 Puntos [00:59] Libelula\SinRespeto
2 Pista: uto*** 30 segundos y 17931 Puntos
[00:59] Libelula\SinRespeto �emuestra lo que sabes arturo23! Has respondido "utopia" correctamente y eso te da: �7931�12 puntos [00:59] Libelula\SinRespeto
�emuestra lo que sabes arturo23! Has respondido "utopia" correctamente y eso te da: �7931�12 puntos
[00:59] Libelula\SinRespeto ACTION awards arturo23 with a +v for having over 15000 points [00:59] Libelula\SinRespeto
ACTION awards arturo23 with a +v for having over 15000 points
[00:59] Libelula\SinRespeto arturo23 has acertado 1 seguidas!! Puntos HOY: 17931, SEMANA: 17931 y MES: 17931 [00:59] Libelula\SinRespeto
arturo23 has acertado 1 seguidas!! Puntos HOY: 17931, SEMANA: 17931 y MES: 17931
[00:59] Libelula\SinRespeto R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0 [00:59] Libelula\SinRespeto
R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0
[00:59] Libelula\SinRespeto Tri.11923 MusicaɃarPEnTer˿(LeswLuthiers)uParawqu郰1upel�lawmudawdelfoesteuescribi󃰱uMastropierowlawm�sicaw?u [00:59] Libelula\SinRespeto
Tri.11923 MusicaɃarPEnTer˿(LeswLuthiers)uParawqu郰1upel�lawmudawdelfoesteuescribi󃰱uMastropierowlawm�sicaw?u
[00:59] Libelula\SinRespeto 1 Pista: ***** ** ***** *** ****** Valor pregunta : 15154 Puntos [00:59] Libelula\SinRespeto
1 Pista: ***** ** ***** *** ****** Valor pregunta : 15154 Puntos
[00:59] Libelula\SinRespeto 2 Pista: kat** ** ***** *** ****** 30 segundos y 15154 Puntos [00:59] Libelula\SinRespeto
2 Pista: kat** ** ***** *** ****** 30 segundos y 15154 Puntos
[00:59] Libelula\SinRespeto 3 Pista: kat** *a *ei*a *e* *a*oo* 15 segundos y 15154 Puntos [00:59] Libelula\SinRespeto
3 Pista: kat** *a *ei*a *e* *a*oo* 15 segundos y 15154 Puntos
[01:00] Libelula\SinRespeto Tiempo! La respuesta es -> kathy�a�eina�el�aloon <- [01:00] Libelula\SinRespeto
Tiempo! La respuesta es -> kathy�a�eina�el�aloon <-
[01:00] Libelula\SinRespeto If you think a Q&A is wrong, please call an OP [01:00] Libelula\SinRespeto
If you think a Q&A is wrong, please call an OP
[01:00] Libelula\SinRespeto Tri.849 HistoriaɊAVEA˿DEsQUEsFUEsSUsGOBERNANTEsENREs1932-34sENGELBERTsDOLLFUSSs?s [01:00] Libelula\SinRespeto
Tri.849 HistoriaɊAVEA˿DEsQUEsFUEsSUsGOBERNANTEsENREs1932-34sENGELBERTsDOLLFUSSs?s
[01:00] Libelula\SinRespeto 1 Pista: ******* Valor pregunta : 9329 Puntos [01:00] Libelula\SinRespeto
1 Pista: ******* Valor pregunta : 9329 Puntos
[01:00] Libelula\SinRespeto 2 Pista: AUS**** 30 segundos y 9329 Puntos [01:00] Libelula\SinRespeto
2 Pista: AUS**** 30 segundos y 9329 Puntos
[01:00] Cocodrilo-ConPrisa austria [01:00] Cocodrilo-ConPrisa
austria
[01:00] Libelula\SinRespeto �Eso es Cocodrilo-ConPrisa!! Dijiste: "austria" y ello te ha valido: �329�12 puntos [01:00] Libelula\SinRespeto
�Eso es Cocodrilo-ConPrisa!! Dijiste: "austria" y ello te ha valido: �329�12 puntos
[01:00] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 1 seguidas!! Puntos HOY: 249488, SEMANA: 13748465 y MES: 13748465 [01:00] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 1 seguidas!! Puntos HOY: 249488, SEMANA: 13748465 y MES: 13748465
[01:00] Libelula\SinRespeto R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0 [01:00] Libelula\SinRespeto
R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0
[01:00] Libelula\SinRespeto Tri.6505 Musicaɔorero˿Abcu᮴ashblancashequivalenstreintadywdoshsemicorcheash?b [01:00] Libelula\SinRespeto
Tri.6505 Musicaɔorero˿Abcu᮴ashblancashequivalenstreintadywdoshsemicorcheash?b
[01:00] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 12542 Puntos [01:00] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 12542 Puntos
[01:01] Libelula\SinRespeto 2 Pista: cua*** 30 segundos y 12542 Puntos [01:01] Libelula\SinRespeto
2 Pista: cua*** 30 segundos y 12542 Puntos
[01:01] Cocodrilo-ConPrisa cuatro [01:01] Cocodrilo-ConPrisa
cuatro
[01:01] Libelula\SinRespeto �Increible!! Cocodrilo-ConPrisa contest󺠃04"cuatro" en �8.219 segundos, y ha ganado �2542�12 puntos [01:01] Libelula\SinRespeto
�Increible!! Cocodrilo-ConPrisa contest󺠃04"cuatro" en �8.219 segundos, y ha ganado �2542�12 puntos
[01:01] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 2 seguidas!! Puntos HOY: 262030, SEMANA: 13761007 y MES: 13761007 [01:01] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 2 seguidas!! Puntos HOY: 262030, SEMANA: 13761007 y MES: 13761007
[01:01] Libelula\SinRespeto For The Competitive Edge type !pingme [01:01] Libelula\SinRespeto
For The Competitive Edge type !pingme
[01:01] Libelula\SinRespeto Tri.17514 Cineɫnna˿Directorwdev"PᮩcotenielmT�nel"y?y [01:01] Libelula\SinRespeto
Tri.17514 Cineɫnna˿Directorwdev"PᮩcotenielmT�nel"y?y
[01:01] Libelula\SinRespeto 1 Pista: *** ***** Valor pregunta : 16833 Puntos [01:01] Libelula\SinRespeto
1 Pista: *** ***** Valor pregunta : 16833 Puntos
[01:01] Cocodrilo-ConPrisa rob chohen [01:01] Cocodrilo-ConPrisa
rob chohen
[01:01] Libelula\SinRespeto 2 Pista: rob ***** 30 segundos y 16833 Puntos [01:01] Libelula\SinRespeto
2 Pista: rob ***** 30 segundos y 16833 Puntos
[01:01] Cocodrilo-ConPrisa rob cohen [01:01] Cocodrilo-ConPrisa
rob cohen
[01:01] Libelula\SinRespeto �As�e hace Cocodrilo-ConPrisa!! Contestaste "rob cohen" en �6.578 segundos y sumas �6833�12 puntos [01:01] Libelula\SinRespeto
�As�e hace Cocodrilo-ConPrisa!! Contestaste "rob cohen" en �6.578 segundos y sumas �6833�12 puntos
[01:01] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 3 seguidas!! Puntos HOY: 278863, SEMANA: 13777840 y MES: 13777840 [01:01] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 3 seguidas!! Puntos HOY: 278863, SEMANA: 13777840 y MES: 13777840
[01:01] Libelula\SinRespeto Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [01:01] Libelula\SinRespeto
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[01:01] Libelula\SinRespeto Tri.8764 Biologiaɐsico666ˬugarkpobladotdefeucaliptosf?u [01:01] Libelula\SinRespeto
Tri.8764 Biologiaɐsico666ˬugarkpobladotdefeucaliptosf?u
[01:01] Libelula\SinRespeto 1 Pista: ********** Valor pregunta : 11065 Puntos [01:01] Libelula\SinRespeto
1 Pista: ********** Valor pregunta : 11065 Puntos
[01:02] Libelula\SinRespeto 2 Pista: euc******* 30 segundos y 11065 Puntos [01:02] Libelula\SinRespeto
2 Pista: euc******* 30 segundos y 11065 Puntos
[01:02] Hipopotamo\Eficiente Eucalitario [01:02] Hipopotamo\Eficiente
Eucalitario
[01:02] Libelula\SinRespeto 3 Pista: euca*i**a* 15 segundos y 11065 Puntos [01:02] Libelula\SinRespeto
3 Pista: euca*i**a* 15 segundos y 11065 Puntos
[01:02] Cocodrilo-ConPrisa eucalitral [01:02] Cocodrilo-ConPrisa
eucalitral
[01:02] Libelula\SinRespeto Tiempo! La respuesta es -> eucaliptal <- [01:02] Libelula\SinRespeto
Tiempo! La respuesta es -> eucaliptal <-
[01:02] Hipopotamo\Eficiente 7.7 [01:02] Hipopotamo\Eficiente
7.7
[01:02] Libelula\SinRespeto R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 14117436 #4: Cocodrilo-ConPrisa 13777840 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3404858 #9: LaCamelia 3029384 #10: Karen 1224969 [01:02] Libelula\SinRespeto
R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 14117436 #4: Cocodrilo-ConPrisa 13777840 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3404858 #9: LaCamelia 3029384 #10: Karen 1224969
[01:02] Libelula\SinRespeto Tri.12063 Idiomasɳorgo˿COMOhDIRIAShENhJAPONES:NEGRO?h?h [01:02] Libelula\SinRespeto
Tri.12063 Idiomasɳorgo˿COMOhDIRIAShENhJAPONES:NEGRO?h?h
[01:02] Libelula\SinRespeto 1 Pista: **** Valor pregunta : 12535 Puntos [01:02] Libelula\SinRespeto
1 Pista: **** Valor pregunta : 12535 Puntos
[01:03] Cocodrilo-ConPrisa kuro [01:03] Cocodrilo-ConPrisa
kuro
[01:03] Libelula\SinRespeto �Enhorabuena Cocodrilo-ConPrisa!! Has contestado "kuro" y por ello has ganado �2535�12 puntos [01:03] Libelula\SinRespeto
�Enhorabuena Cocodrilo-ConPrisa!! Has contestado "kuro" y por ello has ganado �2535�12 puntos
[01:03] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 4 seguidas!! Puntos HOY: 291398, SEMANA: 13790375 y MES: 13790375 [01:03] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 4 seguidas!! Puntos HOY: 291398, SEMANA: 13790375 y MES: 13790375
[01:03] Libelula\SinRespeto Please refrain from using Extreme Bad Language [01:03] Libelula\SinRespeto
Please refrain from using Extreme Bad Language
[01:03] Libelula\SinRespeto Tri.8621 Biologiaɐsico666˥nosusmayor�zlosehongosesehreproducenomediante...z?z [01:03] Libelula\SinRespeto
Tri.8621 Biologiaɐsico666˥nosusmayor�zlosehongosesehreproducenomediante...z?z
[01:03] Libelula\SinRespeto 1 Pista: ******* Valor pregunta : 17433 Puntos [01:03] Libelula\SinRespeto
1 Pista: ******* Valor pregunta : 17433 Puntos
[01:03] Cocodrilo-ConPrisa esporas [01:03] Cocodrilo-ConPrisa
esporas
[01:03] Libelula\SinRespeto �Bingo!! Cocodrilo-ConPrisa dio la respuesta: "esporas" en �3.625 segundos e incrementa sus ganancias con �7433�12 puntos [01:03] Libelula\SinRespeto
�Bingo!! Cocodrilo-ConPrisa dio la respuesta: "esporas" en �3.625 segundos e incrementa sus ganancias con �7433�12 puntos
[01:03] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 5 seguidas!! Puntos HOY: 308831, SEMANA: 13807808 y MES: 13807808 [01:03] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 5 seguidas!! Puntos HOY: 308831, SEMANA: 13807808 y MES: 13807808
[01:03] Libelula\SinRespeto This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto [01:03] Libelula\SinRespeto
This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto
[01:03] Libelula\SinRespeto Tri.13654 Historiaɂuzzati˿ELsDESASTREsDEsANNUALsLOsSUFRIOsESPAсsENsLAsGUERRAsCONTRAsߑUEsPAISs?s [01:03] Libelula\SinRespeto
Tri.13654 Historiaɂuzzati˿ELsDESASTREsDEsANNUALsLOsSUFRIOsESPAсsENsLAsGUERRAsCONTRAsߑUEsPAISs?s
[01:03] Libelula\SinRespeto 1 Pista: ********* Valor pregunta : 14802 Puntos [01:03] Libelula\SinRespeto
1 Pista: ********* Valor pregunta : 14802 Puntos
[01:03] Cocodrilo-ConPrisa marruecos [01:03] Cocodrilo-ConPrisa
marruecos
[01:03] Libelula\SinRespeto �Eso es Cocodrilo-ConPrisa!! Dijiste: "marruecos" y ello te ha valido: �4802�12 puntos [01:03] Libelula\SinRespeto
�Eso es Cocodrilo-ConPrisa!! Dijiste: "marruecos" y ello te ha valido: �4802�12 puntos
[01:03] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 6 seguidas!! Puntos HOY: 323633, SEMANA: 13822610 y MES: 13822610 [01:03] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 6 seguidas!! Puntos HOY: 323633, SEMANA: 13822610 y MES: 13822610
[01:04] Libelula\SinRespeto This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 552740 #19: karen-62 535210 #20: Carlos_55 468075 [01:04] Libelula\SinRespeto
This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 552740 #19: karen-62 535210 #20: Carlos_55 468075
[01:04] Libelula\SinRespeto Tri.8298 Fisica-Quimicaɑuique˿F�colalxcargoldeqlayconstrucci󮃰1udeqlayprimeraypilayat󭩣a,kaut鮴icolprimerkreactorknuclear...k?k [01:04] Libelula\SinRespeto
Tri.8298 Fisica-Quimicaɑuique˿F�colalxcargoldeqlayconstrucci󮃰1udeqlayprimeraypilayat󭩣a,kaut鮴icolprimerkreactorknuclear...k?k
[01:04] Libelula\SinRespeto 1 Pista: ****** ***** Valor pregunta : 21031 Puntos [01:04] Libelula\SinRespeto
1 Pista: ****** ***** Valor pregunta : 21031 Puntos
[01:04] Libelula\SinRespeto 2 Pista: enr*** ***** 30 segundos y 21031 Puntos [01:04] Libelula\SinRespeto
2 Pista: enr*** ***** 30 segundos y 21031 Puntos
[01:04] Cocodrilo-ConPrisa enrico fermi [01:04] Cocodrilo-ConPrisa
enrico fermi
[01:04] Libelula\SinRespeto �emuestra lo que sabes Cocodrilo-ConPrisa! Has respondido "enrico fermi" correctamente y eso te da: �1031�12 puntos [01:04] Libelula\SinRespeto
�emuestra lo que sabes Cocodrilo-ConPrisa! Has respondido "enrico fermi" correctamente y eso te da: �1031�12 puntos
[01:04] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 7 seguidas!! Puntos HOY: 344664, SEMANA: 13843641 y MES: 13843641 [01:04] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 7 seguidas!! Puntos HOY: 344664, SEMANA: 13843641 y MES: 13843641
[01:04] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [01:04] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[01:04] Libelula\SinRespeto Tri.7643 Fisica-QuimicaɈdosO˿Comoydenominamosfaelaerepetici󮃰1xdeuunxsonidoydebidoyaelaereflexi󮃰1xdeulasfondasfsonorasf?s [01:04] Libelula\SinRespeto
Tri.7643 Fisica-QuimicaɈdosO˿Comoydenominamosfaelaerepetici󮃰1xdeuunxsonidoydebidoyaelaereflexi󮃰1xdeulasfondasfsonorasf?s
[01:04] Libelula\SinRespeto 1 Pista: *** Valor pregunta : 8745 Puntos [01:04] Libelula\SinRespeto
1 Pista: *** Valor pregunta : 8745 Puntos
[01:04] Libelula\SinRespeto �Suma y sigue Hipopotamo\Eficiente!! La respuesta: "Eco" incrementa tu marcador en �745�12 puntos [01:04] Libelula\SinRespeto
�Suma y sigue Hipopotamo\Eficiente!! La respuesta: "Eco" incrementa tu marcador en �745�12 puntos
[01:04] Libelula\SinRespeto ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points [01:04] Libelula\SinRespeto
ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points
[01:04] Libelula\SinRespeto Hipopotamo\Eficiente has acertado 1 seguidas!! Puntos HOY: 8745, SEMANA: 3413603 y MES: 3413603 [01:04] Libelula\SinRespeto
Hipopotamo\Eficiente has acertado 1 seguidas!! Puntos HOY: 8745, SEMANA: 3413603 y MES: 3413603
[01:04] Hipopotamo\Eficiente Eco [01:04] Hipopotamo\Eficiente
Eco
[01:04] Cocodrilo-ConPrisa eco [01:04] Cocodrilo-ConPrisa
eco
[01:04] Libelula\SinRespeto This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 559604 #15: Aguila-Especial 543035 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704 [01:04] Libelula\SinRespeto
This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 559604 #15: Aguila-Especial 543035 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704
[01:04] Libelula\SinRespeto Tri.9573 Biologiaɓheva˿AkquenclasendenavenpertencenelbFaisanq?k [01:04] Libelula\SinRespeto
Tri.9573 Biologiaɓheva˿AkquenclasendenavenpertencenelbFaisanq?k
[01:04] Libelula\SinRespeto 1 Pista: ********** Valor pregunta : 19624 Puntos [01:04] Libelula\SinRespeto
1 Pista: ********** Valor pregunta : 19624 Puntos
[01:05] Cocodrilo-ConPrisa phasianidae [01:05] Cocodrilo-ConPrisa
phasianidae
[01:05] Libelula\SinRespeto 2 Pista: gal******* 30 segundos y 19624 Puntos [01:05] Libelula\SinRespeto
2 Pista: gal******* 30 segundos y 19624 Puntos
[01:05] Cocodrilo-ConPrisa galliformes [01:05] Cocodrilo-ConPrisa
galliformes
[01:05] Libelula\SinRespeto 3 Pista: gal*i*a*ea 15 segundos y 19624 Puntos [01:05] Libelula\SinRespeto
3 Pista: gal*i*a*ea 15 segundos y 19624 Puntos
[01:05] Cocodrilo-ConPrisa gallifacia [01:05] Cocodrilo-ConPrisa
gallifacia
[01:05] Hipopotamo\Eficiente Gallinatea [01:05] Hipopotamo\Eficiente
Gallinatea
[01:05] Libelula\SinRespeto Tiempo! La respuesta es -> gallinacea <- [01:05] Libelula\SinRespeto
Tiempo! La respuesta es -> gallinacea <-
[01:05] Hipopotamo\Eficiente Jajaja [01:05] Hipopotamo\Eficiente
Jajaja
[01:05] Libelula\SinRespeto R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0 [01:05] Libelula\SinRespeto
R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0
[01:05] Libelula\SinRespeto Tri.7252 EconomiaɇIOVANNI˿Entderechoytributario,vladdeterminaci󮃰1tdecbasesuimponiblesusontportestimaci󮮮.v?v [01:05] Libelula\SinRespeto
Tri.7252 EconomiaɇIOVANNI˿Entderechoytributario,vladdeterminaci󮃰1tdecbasesuimponiblesusontportestimaci󮮮.v?v
[01:05] Libelula\SinRespeto 1 Pista: ******* ******** * ********* Valor pregunta : 13738 Puntos [01:05] Libelula\SinRespeto
1 Pista: ******* ******** * ********* Valor pregunta : 13738 Puntos
[01:06] Libelula\SinRespeto 2 Pista: dir**** ******** * ********* 30 segundos y 13738 Puntos [01:06] Libelula\SinRespeto
2 Pista: dir**** ******** * ********* 30 segundos y 13738 Puntos
[01:06] LeonConPereza Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas [01:06] LeonConPereza
Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas
[01:06] Libelula\SinRespeto 3 Pista: dire**a o**e*i*a e i**i*e**a 15 segundos y 13738 Puntos [01:06] Libelula\SinRespeto
3 Pista: dire**a o**e*i*a e i**i*e**a 15 segundos y 13738 Puntos
[01:06] Libelula\SinRespeto Tiempo! La respuesta es -> directa�bjetiva��ndirecta <- [01:06] Libelula\SinRespeto
Tiempo! La respuesta es -> directa�bjetiva��ndirecta <-
[01:06] Libelula\SinRespeto Top10 Players ( Weekly & Monthly ) are Auto-Voiced [01:06] Libelula\SinRespeto
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[01:06] Libelula\SinRespeto Tri.20241 Biologiaɐsico666ˣonchawdemlossmoluscoss?f [01:06] Libelula\SinRespeto
Tri.20241 Biologiaɐsico666ˣonchawdemlossmoluscoss?f
[01:06] Libelula\SinRespeto 1 Pista: ***** Valor pregunta : 16680 Puntos [01:06] Libelula\SinRespeto
1 Pista: ***** Valor pregunta : 16680 Puntos
[01:07] Libelula\SinRespeto 2 Pista: val** 30 segundos y 16680 Puntos [01:07] Libelula\SinRespeto
2 Pista: val** 30 segundos y 16680 Puntos
[01:07] Libelula\SinRespeto 3 Pista: val*a 15 segundos y 16680 Puntos [01:07] Libelula\SinRespeto
3 Pista: val*a 15 segundos y 16680 Puntos
[01:07] Cocodrilo-ConPrisa valva [01:07] Cocodrilo-ConPrisa
valva
[01:07] Libelula\SinRespeto �Est᳠que lo tiras Cocodrilo-ConPrisa!! ߃󭯠supiste que "valva" era la respuesta? Venga, �6680�12 puntos suben a tu marcador [01:07] Libelula\SinRespeto
�Est᳠que lo tiras Cocodrilo-ConPrisa!! ߃󭯠supiste que "valva" era la respuesta? Venga, �6680�12 puntos suben a tu marcador
[01:07] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 1 seguidas!! Puntos HOY: 361344, SEMANA: 13860321 y MES: 13860321 [01:07] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 1 seguidas!! Puntos HOY: 361344, SEMANA: 13860321 y MES: 13860321
[01:07] Hipopotamo\Eficiente Valia [01:07] Hipopotamo\Eficiente
Valia
[01:07] Libelula\SinRespeto Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [01:07] Libelula\SinRespeto
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[01:07] Libelula\SinRespeto Tri.1831 Informaticaɤassler˿C󭯃01aselllamadelsprocesadorndeltextosadelMicrosoftb?d?d [01:07] Libelula\SinRespeto
Tri.1831 Informaticaɤassler˿C󭯃01aselllamadelsprocesadorndeltextosadelMicrosoftb?d?d
[01:07] Libelula\SinRespeto 1 Pista: **** Pregunta de BONUS : 25000 Puntos [01:07] Libelula\SinRespeto
1 Pista: **** Pregunta de BONUS : 25000 Puntos
[01:07] Cocodrilo-ConPrisa word [01:07] Cocodrilo-ConPrisa
word
[01:07] Libelula\SinRespeto �Muy bien Cocodrilo-ConPrisa!! Acertaste "word" en tan s󬯠�.578 segundos y por eso has ganado: �5000�12 puntos [01:07] Libelula\SinRespeto
�Muy bien Cocodrilo-ConPrisa!! Acertaste "word" en tan s󬯠�.578 segundos y por eso has ganado: �5000�12 puntos
[01:07] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 2 seguidas!! Puntos HOY: 386344, SEMANA: 13885321 y MES: 13885321 [01:07] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 2 seguidas!! Puntos HOY: 386344, SEMANA: 13885321 y MES: 13885321
[01:07] Libelula\SinRespeto R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 17788999 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 13885321 #5: Culebra}Agil 10719074 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3413603 [01:07] Libelula\SinRespeto
R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 17788999 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 13885321 #5: Culebra}Agil 10719074 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3413603
[01:07] Libelula\SinRespeto Tri.17141 Cienciaɳica˿(Matemᴩcas)Enyestadistica,mcomonsewlewllamaoaolaodiferenciaoentrewelwmayorgyeelwmenorgvalorgdewunyconjuntondewnumerosm?m [01:07] Libelula\SinRespeto
Tri.17141 Cienciaɳica˿(Matemᴩcas)Enyestadistica,mcomonsewlewllamaoaolaodiferenciaoentrewelwmayorgyeelwmenorgvalorgdewunyconjuntondewnumerosm?m
[01:07] Libelula\SinRespeto 1 Pista: ***** Valor pregunta : 18455 Puntos [01:07] Libelula\SinRespeto
1 Pista: ***** Valor pregunta : 18455 Puntos
[01:08] Cocodrilo-ConPrisa rango [01:08] Cocodrilo-ConPrisa
rango
[01:08] Libelula\SinRespeto �Ol頃04Cocodrilo-ConPrisa!! Has contestado: "rango" en �3.906 segundos y sumas �8455�12 puntos a tu marcador. �Sigue as� [01:08] Libelula\SinRespeto
�Ol頃04Cocodrilo-ConPrisa!! Has contestado: "rango" en �3.906 segundos y sumas �8455�12 puntos a tu marcador. �Sigue as�
[01:08] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 3 seguidas!! Puntos HOY: 404799, SEMANA: 13903776 y MES: 13903776 [01:08] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 3 seguidas!! Puntos HOY: 404799, SEMANA: 13903776 y MES: 13903776
[01:08] Libelula\SinRespeto We feature over 50,000 Q&A ! [01:08] Libelula\SinRespeto
We feature over 50,000 Q&A !
[01:08] Libelula\SinRespeto Tri.8650 CienciaɁlkaid˿ENzQUEzPAISzSALIOzALzMERCADOzLAzPRIMERAzCERVEZAzENLATADA?z?z [01:08] Libelula\SinRespeto
Tri.8650 CienciaɁlkaid˿ENzQUEzPAISzSALIOzALzMERCADOzLAzPRIMERAzCERVEZAzENLATADA?z?z
[01:08] Libelula\SinRespeto 1 Pista: ******* ****** Valor pregunta : 22567 Puntos [01:08] Libelula\SinRespeto
1 Pista: ******* ****** Valor pregunta : 22567 Puntos
[01:08] Libelula\SinRespeto 2 Pista: est**** ****** 30 segundos y 22567 Puntos [01:08] Libelula\SinRespeto
2 Pista: est**** ****** 30 segundos y 22567 Puntos
[01:08] Cocodrilo-ConPrisa estados unidos [01:08] Cocodrilo-ConPrisa
estados unidos
[01:08] Libelula\SinRespeto �Suma y sigue Cocodrilo-ConPrisa!! La respuesta: "estados unidos" incrementa tu marcador en �2567�12 puntos [01:08] Libelula\SinRespeto
�Suma y sigue Cocodrilo-ConPrisa!! La respuesta: "estados unidos" incrementa tu marcador en �2567�12 puntos
[01:08] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 4 seguidas!! Puntos HOY: 427366, SEMANA: 13926343 y MES: 13926343 [01:08] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 4 seguidas!! Puntos HOY: 427366, SEMANA: 13926343 y MES: 13926343
[01:08] Libelula\SinRespeto Tri.15226 MitologiaɅME^˿DIOSAvEGIPCIAvDELvCIELOv?v [01:08] Libelula\SinRespeto
Tri.15226 MitologiaɅME^˿DIOSAvEGIPCIAvDELvCIELOv?v
[01:08] Libelula\SinRespeto 1 Pista: *** Valor pregunta : 22632 Puntos [01:08] Libelula\SinRespeto
1 Pista: *** Valor pregunta : 22632 Puntos
[01:08] Cocodrilo-ConPrisa nut [01:08] Cocodrilo-ConPrisa
nut
[01:08] Libelula\SinRespeto �e nota que sabes mucho de esto Cocodrilo-ConPrisa! Tu respuesta "nut" es correcta y ganas �2632�12 puntos [01:08] Libelula\SinRespeto
�e nota que sabes mucho de esto Cocodrilo-ConPrisa! Tu respuesta "nut" es correcta y ganas �2632�12 puntos
[01:08] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 5 seguidas!! Puntos HOY: 449998, SEMANA: 13948975 y MES: 13948975 [01:08] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 5 seguidas!! Puntos HOY: 449998, SEMANA: 13948975 y MES: 13948975
[01:09] Libelula\SinRespeto Tri.945 Informaticaɘove˿EstructurandertranmisionoderdatosaderunanredzoqconjuntoqderellasaenoInternet.aLiteralmente:a"esqueleto"a?a [01:09] Libelula\SinRespeto
Tri.945 Informaticaɘove˿EstructurandertranmisionoderdatosaderunanredzoqconjuntoqderellasaenoInternet.aLiteralmente:a"esqueleto"a?a
[01:09] Libelula\SinRespeto 1 Pista: ******** Valor pregunta : 13745 Puntos [01:09] Libelula\SinRespeto
1 Pista: ******** Valor pregunta : 13745 Puntos
[01:09] Libelula\SinRespeto 2 Pista: Bac***** 30 segundos y 13745 Puntos [01:09] Libelula\SinRespeto
2 Pista: Bac***** 30 segundos y 13745 Puntos
[01:09] Libelula\SinRespeto 3 Pista: Bac**o*e 15 segundos y 13745 Puntos [01:09] Libelula\SinRespeto
3 Pista: Bac**o*e 15 segundos y 13745 Puntos
[01:09] Cocodrilo-ConPrisa backnote [01:09] Cocodrilo-ConPrisa
backnote
[01:09] Libelula\SinRespeto Tiempo! La respuesta es -> Backbone <- [01:09] Libelula\SinRespeto
Tiempo! La respuesta es -> Backbone <-
[01:10] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [01:10] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[01:10] Libelula\SinRespeto Tri.8629 DeporteɁlkaid˿CONyQUEyOTROyNOMBREySEyCONOCEyALyESQUIyDEyFONDO?y?y [01:10] Libelula\SinRespeto
Tri.8629 DeporteɁlkaid˿CONyQUEyOTROyNOMBREySEyCONOCEyALyESQUIyDEyFONDO?y?y
[01:10] Libelula\SinRespeto 1 Pista: ***** ******* Valor pregunta : 14620 Puntos [01:10] Libelula\SinRespeto
1 Pista: ***** ******* Valor pregunta : 14620 Puntos
[01:10] Libelula\SinRespeto 2 Pista: esq** ******* 30 segundos y 14620 Puntos [01:10] Libelula\SinRespeto
2 Pista: esq** ******* 30 segundos y 14620 Puntos
[01:10] Cocodrilo-ConPrisa esqui nordico [01:10] Cocodrilo-ConPrisa
esqui nordico
[01:10] Libelula\SinRespeto �Increible!! Cocodrilo-ConPrisa contest󺠃04"esqui nordico" en �7.422 segundos, y ha ganado �4620�12 puntos [01:10] Libelula\SinRespeto
�Increible!! Cocodrilo-ConPrisa contest󺠃04"esqui nordico" en �7.422 segundos, y ha ganado �4620�12 puntos
[01:10] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 6 seguidas!! Puntos HOY: 464618, SEMANA: 13963595 y MES: 13963595 [01:10] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 6 seguidas!! Puntos HOY: 464618, SEMANA: 13963595 y MES: 13963595
[01:10] Libelula\SinRespeto R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0 [01:10] Libelula\SinRespeto
R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0
[01:10] Libelula\SinRespeto Tri.15536 CienciaɐEDROC˿LASnFAMOSASnESTRELLASnMERAKnYnDUBHEnPERTENECENnAnQUEnCONSTELACIONn?n?n [01:10] Libelula\SinRespeto
Tri.15536 CienciaɐEDROC˿LASnFAMOSASnESTRELLASnMERAKnYnDUBHEnPERTENECENnAnQUEnCONSTELACIONn?n?n
[01:10] Libelula\SinRespeto 1 Pista: *** ***** Valor pregunta : 10285 Puntos [01:10] Libelula\SinRespeto
1 Pista: *** ***** Valor pregunta : 10285 Puntos
[01:10] Libelula\SinRespeto 2 Pista: osa ***** 30 segundos y 10285 Puntos [01:10] Libelula\SinRespeto
2 Pista: osa ***** 30 segundos y 10285 Puntos
[01:11] Hipopotamo\Eficiente Osa mayor [01:11] Hipopotamo\Eficiente
Osa mayor
[01:11] Libelula\SinRespeto �Bien Hipopotamo\Eficiente!! Tu respuesta: "Osa mayor" es correcta y ganas �0285�12 puntos [01:11] Libelula\SinRespeto
�Bien Hipopotamo\Eficiente!! Tu respuesta: "Osa mayor" es correcta y ganas �0285�12 puntos
[01:11] Libelula\SinRespeto ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points [01:11] Libelula\SinRespeto
ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points
[01:11] Libelula\SinRespeto Hipopotamo\Eficiente has acertado 1 seguidas!! Puntos HOY: 19030, SEMANA: 3423888 y MES: 3423888 [01:11] Libelula\SinRespeto
Hipopotamo\Eficiente has acertado 1 seguidas!! Puntos HOY: 19030, SEMANA: 3423888 y MES: 3423888
[01:11] Libelula\SinRespeto If you think a Q&A is wrong, please call an OP [01:11] Libelula\SinRespeto
If you think a Q&A is wrong, please call an OP
[01:11] Libelula\SinRespeto Tri.16172 MiscelaneaɎAPINE˿CICERON:sDEsHUMANOSsESsERRARsYsDEsNECIOS...s?s [01:11] Libelula\SinRespeto
Tri.16172 MiscelaneaɎAPINE˿CICERON:sDEsHUMANOSsESsERRARsYsDEsNECIOS...s?s
[01:11] Libelula\SinRespeto 1 Pista: ********** ** ** ***** Valor pregunta : 23204 Puntos [01:11] Libelula\SinRespeto
1 Pista: ********** ** ** ***** Valor pregunta : 23204 Puntos
[01:11] Libelula\SinRespeto 2 Pista: per******* ** ** ***** 30 segundos y 23204 Puntos [01:11] Libelula\SinRespeto
2 Pista: per******* ** ** ***** 30 segundos y 23204 Puntos
[01:11] Libelula\SinRespeto 3 Pista: per*a*e*e* e* e* e**o* 15 segundos y 23204 Puntos [01:11] Libelula\SinRespeto
3 Pista: per*a*e*e* e* e* e**o* 15 segundos y 23204 Puntos
[01:12] Libelula\SinRespeto Tiempo! La respuesta es -> permanecer�n�l�rror <- [01:12] Libelula\SinRespeto
Tiempo! La respuesta es -> permanecer�n�l�rror <-
[01:12] Libelula\SinRespeto R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0 [01:12] Libelula\SinRespeto
R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0
[01:12] Libelula\SinRespeto Tri.8631 MiscelaneaɔeLaRaNhA˿Elsqueosaneoguardarbunqsecretosesiporqueo?y [01:12] Libelula\SinRespeto
Tri.8631 MiscelaneaɔeLaRaNhA˿Elsqueosaneoguardarbunqsecretosesiporqueo?y
[01:12] Libelula\SinRespeto 1 Pista: **** ****** Valor pregunta : 14675 Puntos [01:12] Libelula\SinRespeto
1 Pista: **** ****** Valor pregunta : 14675 Puntos
[01:12] Libelula\SinRespeto 2 Pista: est* ****** 30 segundos y 14675 Puntos [01:12] Libelula\SinRespeto
2 Pista: est* ****** 30 segundos y 14675 Puntos
[01:12] Libelula\SinRespeto 3 Pista: esta *ue**o 15 segundos y 14675 Puntos [01:12] Libelula\SinRespeto
3 Pista: esta *ue**o 15 segundos y 14675 Puntos
[01:12] Hipopotamo\Eficiente Esta sordo [01:12] Hipopotamo\Eficiente
Esta sordo
[01:12] Libelula\SinRespeto �Hipopotamo\Eficiente acert󡡠La respuesta era: "Esta muerto" y contest󠥮 �6.796 segundos. Se lleva: �4675�12 puntos [01:12] Libelula\SinRespeto
�Hipopotamo\Eficiente acert󡡠La respuesta era: "Esta muerto" y contest󠥮 �6.796 segundos. Se lleva: �4675�12 puntos
[01:12] Libelula\SinRespeto ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points [01:12] Libelula\SinRespeto
ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points
[01:12] Libelula\SinRespeto Hipopotamo\Eficiente has acertado 2 seguidas!! Puntos HOY: 33705, SEMANA: 3438563 y MES: 3438563 [01:12] Libelula\SinRespeto
Hipopotamo\Eficiente has acertado 2 seguidas!! Puntos HOY: 33705, SEMANA: 3438563 y MES: 3438563
[01:12] Hipopotamo\Eficiente Esta muerto [01:12] Hipopotamo\Eficiente
Esta muerto
[01:13] Libelula\SinRespeto For The Competitive Edge type !pingme [01:13] Libelula\SinRespeto
For The Competitive Edge type !pingme
[01:13] Libelula\SinRespeto Tri.12410 Cotilleo-TVɃarPEnTer˿C󭯃01gsewllamalelojefewdewDarrin,fenilalseriew"Embrujada"f?f [01:13] Libelula\SinRespeto
Tri.12410 Cotilleo-TVɃarPEnTer˿C󭯃01gsewllamalelojefewdewDarrin,fenilalseriew"Embrujada"f?f
[01:13] Libelula\SinRespeto 1 Pista: ***** **** Valor pregunta : 20383 Puntos [01:13] Libelula\SinRespeto
1 Pista: ***** **** Valor pregunta : 20383 Puntos
[01:13] Libelula\SinRespeto 2 Pista: lar** **** 30 segundos y 20383 Puntos [01:13] Libelula\SinRespeto
2 Pista: lar** **** 30 segundos y 20383 Puntos
[01:13] Libelula\SinRespeto 3 Pista: lar** *a*e 15 segundos y 20383 Puntos [01:13] Libelula\SinRespeto
3 Pista: lar** *a*e 15 segundos y 20383 Puntos
[01:13] Libelula\SinRespeto Tiempo! La respuesta es -> larry�ate <- [01:13] Libelula\SinRespeto
Tiempo! La respuesta es -> larry�ate <-
[01:13] Libelula\SinRespeto Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [01:13] Libelula\SinRespeto
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[01:13] Libelula\SinRespeto Tri.8009 CineɍARdeJAVA˓IMBAyEST�01yPREDESTINADOyAySERyELyREYyDEyLAySABANA,yPEROySUyMALVADOyT͏ySCARyPLANEAyHACERSEyCONyELyTRONO,yMATAyAySUyPADREyYyLOyOBLIGAyAyEXILIARSE.yUNyTIEMPOyM�yTARDE,ySIMBAyVUELVEyPARAyRECUPERARyELyREINO.߄EyQUɃ01yPEL [01:13] Libelula\SinRespeto
Tri.8009 CineɍARdeJAVA˓IMBAyEST�01yPREDESTINADOyAySERyELyREYyDEyLAySABANA,yPEROySUyMALVADOyT͏ySCARyPLANEAyHACERSEyCONyELyTRONO,yMATAyAySUyPADREyYyLOyOBLIGAyAyEXILIARSE.yUNyTIEMPOyM�yTARDE,ySIMBAyVUELVEyPARAyRECUPERARyELyREINO.߄EyQUɃ01yPEL
[01:13] Libelula\SinRespeto 1 Pista: ** *** **** Valor pregunta : 17634 Puntos [01:13] Libelula\SinRespeto
1 Pista: ** *** **** Valor pregunta : 17634 Puntos
[01:14] Libelula\SinRespeto 2 Pista: el�** **** 30 segundos y 17634 Puntos [01:14] Libelula\SinRespeto
2 Pista: el�** **** 30 segundos y 17634 Puntos
[01:14] Libelula\SinRespeto 3 Pista: el�e* *eo* 15 segundos y 17634 Puntos [01:14] Libelula\SinRespeto
3 Pista: el�e* *eo* 15 segundos y 17634 Puntos
[01:14] Hipopotamo\Eficiente El rey leon [01:14] Hipopotamo\Eficiente
El rey leon
[01:14] Libelula\SinRespeto �Eso es Hipopotamo\Eficiente!! Dijiste: "El rey leon" y ello te ha valido: �7634�12 puntos [01:14] Libelula\SinRespeto
�Eso es Hipopotamo\Eficiente!! Dijiste: "El rey leon" y ello te ha valido: �7634�12 puntos
[01:14] Libelula\SinRespeto ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points [01:14] Libelula\SinRespeto
ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points
[01:14] Libelula\SinRespeto Hipopotamo\Eficiente has acertado 3 seguidas!! Puntos HOY: 51339, SEMANA: 3456197 y MES: 3456197 [01:14] Libelula\SinRespeto
Hipopotamo\Eficiente has acertado 3 seguidas!! Puntos HOY: 51339, SEMANA: 3456197 y MES: 3456197
[01:14] Libelula\SinRespeto R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 14117436 #4: Cocodrilo-ConPrisa 13963595 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3438563 #9: LaCamelia 3029384 #10: Karen 1224969 [01:14] Libelula\SinRespeto
R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 14117436 #4: Cocodrilo-ConPrisa 13963595 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3438563 #9: LaCamelia 3029384 #10: Karen 1224969
[01:14] Libelula\SinRespeto Tri.8609 Idiomasɦlipp_er˿FRANCES--->ESPAяL:esprity?n [01:14] Libelula\SinRespeto
Tri.8609 Idiomasɦlipp_er˿FRANCES--->ESPAяL:esprity?n
[01:14] Libelula\SinRespeto 1 Pista: ******** Valor pregunta : 5703 Puntos [01:14] Libelula\SinRespeto
1 Pista: ******** Valor pregunta : 5703 Puntos
[01:15] Libelula\SinRespeto �e nota que sabes mucho de esto Hipopotamo\Eficiente! Tu respuesta "Espiritu" es correcta y ganas �703�12 puntos [01:15] Libelula\SinRespeto
�e nota que sabes mucho de esto Hipopotamo\Eficiente! Tu respuesta "Espiritu" es correcta y ganas �703�12 puntos
[01:15] Libelula\SinRespeto ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points [01:15] Libelula\SinRespeto
ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points
[01:15] Libelula\SinRespeto Hipopotamo\Eficiente has acertado 4 seguidas!! Puntos HOY: 57042, SEMANA: 3461900 y MES: 3461900 [01:15] Libelula\SinRespeto
Hipopotamo\Eficiente has acertado 4 seguidas!! Puntos HOY: 57042, SEMANA: 3461900 y MES: 3461900
[01:15] Hipopotamo\Eficiente Espiritu [01:15] Hipopotamo\Eficiente
Espiritu
[01:15] Libelula\SinRespeto Please refrain from using Extreme Bad Language [01:15] Libelula\SinRespeto
Please refrain from using Extreme Bad Language
[01:15] Libelula\SinRespeto Tri.12072 Deporteɨupper˿CUALnESnELnPUERTOnMONATA񏓏SnMASnDUROnDELnMUNDOnDELnCICLISMO?n?n [01:15] Libelula\SinRespeto
Tri.12072 Deporteɨupper˿CUALnESnELnPUERTOnMONATA񏓏SnMASnDUROnDELnMUNDOnDELnCICLISMO?n?n
[01:15] Libelula\SinRespeto 1 Pista: *'******* Valor pregunta : 21382 Puntos [01:15] Libelula\SinRespeto
1 Pista: *'******* Valor pregunta : 21382 Puntos
[01:15] Libelula\SinRespeto 2 Pista: l'a****** 30 segundos y 21382 Puntos [01:15] Libelula\SinRespeto
2 Pista: l'a****** 30 segundos y 21382 Puntos
[01:15] Libelula\SinRespeto 3 Pista: l'a***i*u 15 segundos y 21382 Puntos [01:15] Libelula\SinRespeto
3 Pista: l'a***i*u 15 segundos y 21382 Puntos
[01:15] Libelula\SinRespeto Tiempo! La respuesta es -> l'angliru <- [01:15] Libelula\SinRespeto
Tiempo! La respuesta es -> l'angliru <-
[01:16] Libelula\SinRespeto This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto [01:16] Libelula\SinRespeto
This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto
[01:16] Libelula\SinRespeto Tri.17335 Historiaɴamzarian˿EnelakAm鲩cakcolonial,hdistribuci󮃰1edenmercanc�pentrenlospindiospquenestospestabaneobligadospakadquirirc?h [01:16] Libelula\SinRespeto
Tri.17335 Historiaɴamzarian˿EnelakAm鲩cakcolonial,hdistribuci󮃰1edenmercanc�pentrenlospindiospquenestospestabaneobligadospakadquirirc?h
[01:16] Libelula\SinRespeto 1 Pista: ************* Valor pregunta : 6350 Puntos [01:16] Libelula\SinRespeto
1 Pista: ************* Valor pregunta : 6350 Puntos
[01:16] Libelula\SinRespeto 2 Pista: rep********** 30 segundos y 6350 Puntos [01:16] Libelula\SinRespeto
2 Pista: rep********** 30 segundos y 6350 Puntos
[01:16] Libelula\SinRespeto 3 Pista: repa**i*ie**o 15 segundos y 6350 Puntos [01:16] Libelula\SinRespeto
3 Pista: repa**i*ie**o 15 segundos y 6350 Puntos
[01:16] Libelula\SinRespeto Tiempo! La respuesta es -> repartimiento <- [01:16] Libelula\SinRespeto
Tiempo! La respuesta es -> repartimiento <-
[01:17] Libelula\SinRespeto This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 552740 #19: karen-62 535210 #20: Carlos_55 468075 [01:17] Libelula\SinRespeto
This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 552740 #19: karen-62 535210 #20: Carlos_55 468075
[01:17] Libelula\SinRespeto Tri.11720 LiteraturaɁcuarios˿AUTORhDEhELhCABRERILLOh?h [01:17] Libelula\SinRespeto
Tri.11720 LiteraturaɁcuarios˿AUTORhDEhELhCABRERILLOh?h
[01:17] Libelula\SinRespeto 1 Pista: **** ******* ** ** ******* Valor pregunta : 10536 Puntos [01:17] Libelula\SinRespeto
1 Pista: **** ******* ** ** ******* Valor pregunta : 10536 Puntos
[01:17] LeonConPereza Bienvenido/a! gatoazull__ [Fan] de .::RadioLuna::. [01:17] LeonConPereza
Bienvenido/a! gatoazull__ [Fan] de .::RadioLuna::.
[01:17] Libelula\SinRespeto 2 Pista: jua* ******* ** ** ******* 30 segundos y 10536 Puntos [01:17] Libelula\SinRespeto
2 Pista: jua* ******* ** ** ******* 30 segundos y 10536 Puntos
[01:17] Libelula\SinRespeto 3 Pista: jua* a**o*io *e *a i**e*ia 15 segundos y 10536 Puntos [01:17] Libelula\SinRespeto
3 Pista: jua* a**o*io *e *a i**e*ia 15 segundos y 10536 Puntos
[01:17] Libelula\SinRespeto Tiempo! La respuesta es -> juan�ntonio�e�a�glesia <- [01:17] Libelula\SinRespeto
Tiempo! La respuesta es -> juan�ntonio�e�a�glesia <-
[01:18] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [01:18] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[01:18] Libelula\SinRespeto Tri.20772 Literaturaɲaziel9˿DedquedsiglogesfelmcantaredelmMiogCid?t?t [01:18] Libelula\SinRespeto
Tri.20772 Literaturaɲaziel9˿DedquedsiglogesfelmcantaredelmMiogCid?t?t
[01:18] Libelula\SinRespeto 1 Pista: *** Valor pregunta : 8249 Puntos [01:18] Libelula\SinRespeto
1 Pista: *** Valor pregunta : 8249 Puntos
[01:18] Libelula\SinRespeto 2 Pista: xii 30 segundos y 8249 Puntos [01:18] Libelula\SinRespeto
2 Pista: xii 30 segundos y 8249 Puntos
[01:18] Libelula\SinRespeto 3 Pista: xii 15 segundos y 8249 Puntos [01:18] Libelula\SinRespeto
3 Pista: xii 15 segundos y 8249 Puntos
[01:18] Libelula\SinRespeto Tiempo! La respuesta es -> xii <- [01:18] Libelula\SinRespeto
Tiempo! La respuesta es -> xii <-
[01:18] Libelula\SinRespeto This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 559604 #15: Aguila-Especial 543035 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704 [01:18] Libelula\SinRespeto
This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 559604 #15: Aguila-Especial 543035 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704
[01:18] Libelula\SinRespeto Tri.9340 Cineɴamzarian˿Actorsespa񯬃01kcuyasxdotesxcinematograficasxfueronpdescubiertasxcuandoutrabajabaudexelectricistauenpunosxestudiosx?j [01:18] Libelula\SinRespeto
Tri.9340 Cineɴamzarian˿Actorsespa񯬃01kcuyasxdotesxcinematograficasxfueronpdescubiertasxcuandoutrabajabaudexelectricistauenpunosxestudiosx?j
[01:18] Libelula\SinRespeto 1 Pista: ********* ***** Pregunta de BONUS : 25000 Puntos [01:18] Libelula\SinRespeto
1 Pista: ********* ***** Pregunta de BONUS : 25000 Puntos
[01:19] Libelula\SinRespeto 2 Pista: fra****** ***** 30 segundos y 25000 Puntos [01:19] Libelula\SinRespeto
2 Pista: fra****** ***** 30 segundos y 25000 Puntos
[01:19] Libelula\SinRespeto 3 Pista: fra**i**o *a*a* 15 segundos y 25000 Puntos [01:19] Libelula\SinRespeto
3 Pista: fra**i**o *a*a* 15 segundos y 25000 Puntos
[01:19] Libelula\SinRespeto Tiempo! La respuesta es -> francisco�abal <- [01:19] Libelula\SinRespeto
Tiempo! La respuesta es -> francisco�abal <-
[01:19] Libelula\SinRespeto R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0 [01:19] Libelula\SinRespeto
R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0
[01:19] Libelula\SinRespeto Tri.9809 Gastronomiaɓebosin˿C󭯃01ksehllamadladespumaddehladcerveza?v?v [01:19] Libelula\SinRespeto
Tri.9809 Gastronomiaɓebosin˿C󭯃01ksehllamadladespumaddehladcerveza?v?v
[01:19] Libelula\SinRespeto 1 Pista: ***** Valor pregunta : 7573 Puntos [01:19] Libelula\SinRespeto
1 Pista: ***** Valor pregunta : 7573 Puntos
[01:20] Libelula\SinRespeto 2 Pista: gis** 30 segundos y 7573 Puntos [01:20] Libelula\SinRespeto
2 Pista: gis** 30 segundos y 7573 Puntos
[01:20] Libelula\SinRespeto 3 Pista: gis*e 15 segundos y 7573 Puntos [01:20] Libelula\SinRespeto
3 Pista: gis*e 15 segundos y 7573 Puntos
[01:20] Libelula\SinRespeto Tiempo! La respuesta es -> giste <- [01:20] Libelula\SinRespeto
Tiempo! La respuesta es -> giste <-
[01:20] Libelula\SinRespeto Top10 Players ( Weekly & Monthly ) are Auto-Voiced [01:20] Libelula\SinRespeto
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[01:20] Libelula\SinRespeto Tri.8727 Cienciaɴamzarian˿Asqu郰1sefectonseudebeuqueuenualgunassfilmacionesslassruedassdeucarrossonbicicletassparezcanurodarelentamenteuyeenusentidoncontrarionarlarmarcha?s?s [01:20] Libelula\SinRespeto
Tri.8727 Cienciaɴamzarian˿Asqu郰1sefectonseudebeuqueuenualgunassfilmacionesslassruedassdeucarrossonbicicletassparezcanurodarelentamenteuyeenusentidoncontrarionarlarmarcha?s?s
[01:20] Libelula\SinRespeto 1 Pista: ************** Valor pregunta : 10912 Puntos [01:20] Libelula\SinRespeto
1 Pista: ************** Valor pregunta : 10912 Puntos
[01:21] Libelula\SinRespeto 2 Pista: est*********** 30 segundos y 10912 Puntos [01:21] Libelula\SinRespeto
2 Pista: est*********** 30 segundos y 10912 Puntos
[01:21] Libelula\SinRespeto 3 Pista: est*o*o**o*i*o 15 segundos y 10912 Puntos [01:21] Libelula\SinRespeto
3 Pista: est*o*o**o*i*o 15 segundos y 10912 Puntos
[01:21] Libelula\SinRespeto Tiempo! La respuesta es -> estroboscopico <- [01:21] Libelula\SinRespeto
Tiempo! La respuesta es -> estroboscopico <-
[01:21] Libelula\SinRespeto Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [01:21] Libelula\SinRespeto
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[01:21] Libelula\SinRespeto Tri.15192 CineɌopes˿Comobseollamaklakversionmpornograficakdeo'nueveosemanaszypmedia'j?j [01:21] Libelula\SinRespeto
Tri.15192 CineɌopes˿Comobseollamaklakversionmpornograficakdeo'nueveosemanaszypmedia'j?j
[01:21] Libelula\SinRespeto 1 Pista: ***** ***** * ***** Valor pregunta : 19376 Puntos [01:21] Libelula\SinRespeto
1 Pista: ***** ***** * ***** Valor pregunta : 19376 Puntos
[01:21] OvejaSinLuces alitas muackssssssssssssssssssssssssss [01:21] OvejaSinLuces
alitas muackssssssssssssssssssssssssss
[01:22] Libelula\SinRespeto 2 Pista: nue** ***** * ***** 30 segundos y 19376 Puntos [01:22] Libelula\SinRespeto
2 Pista: nue** ***** * ***** 30 segundos y 19376 Puntos
[01:22] Rana}ConBravura Krysta saludos y feliz año novo amiga [01:22] Rana}ConBravura
Krysta saludos y feliz año novo amiga
[01:22] Rana}ConBravura que tal va todo? [01:22] Rana}ConBravura
que tal va todo?
[01:22] Libelula\SinRespeto 3 Pista: nue*e *e*e* * *e*io 15 segundos y 19376 Puntos [01:22] Libelula\SinRespeto
3 Pista: nue*e *e*e* * *e*io 15 segundos y 19376 Puntos
[01:22] Rana}ConBravura espero que super ben [01:22] Rana}ConBravura
espero que super ben
[01:22] OvejaSinLuces Rana}ConBravura holaaaaaaaaa feliz año [01:22] OvejaSinLuces
Rana}ConBravura holaaaaaaaaa feliz año
[01:22] Libelula\SinRespeto Tiempo! La respuesta es -> nueve�eses��edio <- [01:22] Libelula\SinRespeto
Tiempo! La respuesta es -> nueve�eses��edio <-
[01:22] Libelula\SinRespeto R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 17788999 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 13963595 #5: Culebra}Agil 10719074 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3461900 [01:22] Libelula\SinRespeto
R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 17788999 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 13963595 #5: Culebra}Agil 10719074 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3461900
[01:22] Libelula\SinRespeto Tri.10357 Historiaɦrederikˑui鮃01edescubri󃰱tlasaruinasadexTroya?t?t [01:22] Libelula\SinRespeto
Tri.10357 Historiaɦrederikˑui鮃01edescubri󃰱tlasaruinasadexTroya?t?t
[01:22] Libelula\SinRespeto 1 Pista: ******** ********** Valor pregunta : 16522 Puntos [01:22] Libelula\SinRespeto
1 Pista: ******** ********** Valor pregunta : 16522 Puntos
[01:22] Libelula\SinRespeto 2 Pista: hei***** ********** 30 segundos y 16522 Puntos [01:22] Libelula\SinRespeto
2 Pista: hei***** ********** 30 segundos y 16522 Puntos
[01:23] Rana}ConBravura gracias [01:23] Rana}ConBravura
gracias
[01:23] Libelula\SinRespeto 3 Pista: hei**i** ****ie*a** 15 segundos y 16522 Puntos [01:23] Libelula\SinRespeto
3 Pista: hei**i** ****ie*a** 15 segundos y 16522 Puntos
[01:23] Rana}ConBravura igualmente Krysta [01:23] Rana}ConBravura
igualmente Krysta
[01:23] Hipopotamo\Eficiente Krysta no te has muerto [01:23] Hipopotamo\Eficiente
Krysta no te has muerto
[01:23] Libelula\SinRespeto Tiempo! La respuesta es -> heinrich�chliemann <- [01:23] Libelula\SinRespeto
Tiempo! La respuesta es -> heinrich�chliemann <-
[01:23] Hipopotamo\Eficiente Rana}ConBravura holi [01:23] Hipopotamo\Eficiente
Rana}ConBravura holi
[01:23] OvejaSinLuces jaaaaaaaaaa alitas ya quisieras [01:23] OvejaSinLuces
jaaaaaaaaaa alitas ya quisieras
[01:23] Libelula\SinRespeto We feature over 50,000 Q&A ! [01:23] Libelula\SinRespeto
We feature over 50,000 Q&A !
[01:23] Libelula\SinRespeto Tri.11821 PoliticaɁnghara˿DiputadoxdeaIUequeaantescfueaAlcaldeadeaC󲤯baa(nombreaylapellido)e?e [01:23] Libelula\SinRespeto
Tri.11821 PoliticaɁnghara˿DiputadoxdeaIUequeaantescfueaAlcaldeadeaC󲤯baa(nombreaylapellido)e?e
[01:23] Libelula\SinRespeto 1 Pista: ***** ******* Valor pregunta : 11730 Puntos [01:23] Libelula\SinRespeto
1 Pista: ***** ******* Valor pregunta : 11730 Puntos
[01:23] Hipopotamo\Eficiente OvejaSinLuces: jajajaja jajajaja jajajaja [01:23] Hipopotamo\Eficiente
OvejaSinLuces: jajajaja jajajaja jajajaja
[01:23] Hipopotamo\Eficiente Pense [01:23] Hipopotamo\Eficiente
Pense
[01:23] Hipopotamo\Eficiente Ayss [01:23] Hipopotamo\Eficiente
Ayss
[01:23] Libelula\SinRespeto 2 Pista: jul** ******* 30 segundos y 11730 Puntos [01:23] Libelula\SinRespeto
2 Pista: jul** ******* 30 segundos y 11730 Puntos
[01:24] OvejaSinLuces alitas asi matas a tu nuera favorita XD [01:24] OvejaSinLuces
alitas asi matas a tu nuera favorita XD
[01:24] Libelula\SinRespeto 3 Pista: julio a**ui*a 15 segundos y 11730 Puntos [01:24] Libelula\SinRespeto
3 Pista: julio a**ui*a 15 segundos y 11730 Puntos
[01:24] OvejaSinLuces MALOSA [01:24] OvejaSinLuces
MALOSA
[01:24] Rana}ConBravura alitas holaaaa [01:24] Rana}ConBravura
alitas holaaaa
[01:24] Hipopotamo\Eficiente OvejaSinLuces: donde dejaste a mi hiji [01:24] Hipopotamo\Eficiente
OvejaSinLuces: donde dejaste a mi hiji
[01:24] Libelula\SinRespeto Tiempo! La respuesta es -> julio�nguita <- [01:24] Libelula\SinRespeto
Tiempo! La respuesta es -> julio�nguita <-
[01:24] Hipopotamo\Eficiente To [01:24] Hipopotamo\Eficiente
To
[01:24] Libelula\SinRespeto Tri.3470 Miscelaneaɓebosin˿Diccionario-Estimularaelrjinetevalrcaballojconolasspiernas?v?v [01:24] Libelula\SinRespeto
Tri.3470 Miscelaneaɓebosin˿Diccionario-Estimularaelrjinetevalrcaballojconolasspiernas?v?v
[01:24] Libelula\SinRespeto 1 Pista: ******* Valor pregunta : 15600 Puntos [01:24] Libelula\SinRespeto
1 Pista: ******* Valor pregunta : 15600 Puntos
[01:24] OvejaSinLuces alitas pues pregunta a manito que todo se lleva [01:24] OvejaSinLuces
alitas pues pregunta a manito que todo se lleva
[01:24] Libelula\SinRespeto 2 Pista: ato**** 30 segundos y 15600 Puntos [01:24] Libelula\SinRespeto
2 Pista: ato**** 30 segundos y 15600 Puntos
[01:25] Libelula\SinRespeto 3 Pista: ato**a* 15 segundos y 15600 Puntos [01:25] Libelula\SinRespeto
3 Pista: ato**a* 15 segundos y 15600 Puntos
[01:25] Libelula\SinRespeto Tiempo! La respuesta es -> atondar <- [01:25] Libelula\SinRespeto
Tiempo! La respuesta es -> atondar <-
[01:25] Libelula\SinRespeto Tri.18828 CineɅspufi˿Cuᬃ01qesdelqnombreicompletoddeiSpielbergp?d [01:25] Libelula\SinRespeto
Tri.18828 CineɅspufi˿Cuᬃ01qesdelqnombreicompletoddeiSpielbergp?d
[01:25] Libelula\SinRespeto 1 Pista: ****** ***** ********* Valor pregunta : 6590 Puntos [01:25] Libelula\SinRespeto
1 Pista: ****** ***** ********* Valor pregunta : 6590 Puntos
[01:25] Libelula\SinRespeto 2 Pista: ste*** ***** ********* 30 segundos y 6590 Puntos [01:25] Libelula\SinRespeto
2 Pista: ste*** ***** ********* 30 segundos y 6590 Puntos
[01:26] Libelula\SinRespeto 3 Pista: ste*e* a**a* **ie**e** 15 segundos y 6590 Puntos [01:26] Libelula\SinRespeto
3 Pista: ste*e* a**a* **ie**e** 15 segundos y 6590 Puntos
[01:26] LeonConPereza Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas [01:26] LeonConPereza
Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas
[01:26] Libelula\SinRespeto Tiempo! La respuesta es -> steven�llan�pielberg <- [01:26] Libelula\SinRespeto
Tiempo! La respuesta es -> steven�llan�pielberg <-
[01:26] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [01:26] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[01:26] Libelula\SinRespeto Tri.5353 CancionesɃheewakka˿Dejquienqesv"TranquilojMajete"f?f [01:26] Libelula\SinRespeto
Tri.5353 CancionesɃheewakka˿Dejquienqesv"TranquilojMajete"f?f
[01:26] Libelula\SinRespeto 1 Pista: ****** ****** Valor pregunta : 12223 Puntos [01:26] Libelula\SinRespeto
1 Pista: ****** ****** Valor pregunta : 12223 Puntos
[01:26] Libelula\SinRespeto 2 Pista: cel*** ****** 30 segundos y 12223 Puntos [01:26] Libelula\SinRespeto
2 Pista: cel*** ****** 30 segundos y 12223 Puntos
[01:26] Libelula\SinRespeto 3 Pista: cel*a* *o**o* 15 segundos y 12223 Puntos [01:26] Libelula\SinRespeto
3 Pista: cel*a* *o**o* 15 segundos y 12223 Puntos
[01:27] Libelula\SinRespeto Tiempo! La respuesta es -> celtas�ortos <- [01:27] Libelula\SinRespeto
Tiempo! La respuesta es -> celtas�ortos <-
[01:27] Libelula\SinRespeto R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0 [01:27] Libelula\SinRespeto
R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0
[01:27] Libelula\SinRespeto Tri.17208 MiscelaneaɌopes_˿Doctrinabquecafirmabquecelwserzesnindependientecdelwespirituxquecloppercibec?m [01:27] Libelula\SinRespeto
Tri.17208 MiscelaneaɌopes_˿Doctrinabquecafirmabquecelwserzesnindependientecdelwespirituxquecloppercibec?m
[01:27] Libelula\SinRespeto 1 Pista: ******** Pregunta de BONUS : 25000 Puntos [01:27] Libelula\SinRespeto
1 Pista: ******** Pregunta de BONUS : 25000 Puntos
[01:27] Libelula\SinRespeto 2 Pista: rea***** 30 segundos y 25000 Puntos [01:27] Libelula\SinRespeto
2 Pista: rea***** 30 segundos y 25000 Puntos
[01:27] Hipopotamo\Eficiente OvejaSinLuces: jajajajaja a mí me dijeron a tu [01:27] Hipopotamo\Eficiente
OvejaSinLuces: jajajajaja a mí me dijeron a tu
[01:27] Libelula\SinRespeto 3 Pista: rea*i**o 15 segundos y 25000 Puntos [01:27] Libelula\SinRespeto
3 Pista: rea*i**o 15 segundos y 25000 Puntos
[01:28] Libelula\SinRespeto Tiempo! La respuesta es -> realismo <- [01:28] Libelula\SinRespeto
Tiempo! La respuesta es -> realismo <-
[01:28] Libelula\SinRespeto If you think a Q&A is wrong, please call an OP [01:28] Libelula\SinRespeto
If you think a Q&A is wrong, please call an OP
[01:28] Libelula\SinRespeto Tri.10521 Cancionesɤassler˿Deyqui鮃01hesxlapcanci󮃰1h"jJoinhmeyinhdeathu"j?"j?j [01:28] Libelula\SinRespeto
Tri.10521 Cancionesɤassler˿Deyqui鮃01hesxlapcanci󮃰1h"jJoinhmeyinhdeathu"j?"j?j
[01:28] Libelula\SinRespeto 1 Pista: *** Valor pregunta : 5988 Puntos [01:28] Libelula\SinRespeto
1 Pista: *** Valor pregunta : 5988 Puntos
[01:28] Libelula\SinRespeto 2 Pista: him 30 segundos y 5988 Puntos [01:28] Libelula\SinRespeto
2 Pista: him 30 segundos y 5988 Puntos
[01:28] Hipopotamo\Eficiente Him [01:28] Hipopotamo\Eficiente
Him
[01:28] Libelula\SinRespeto �Absolutamente correcto Hipopotamo\Eficiente!! Acertaste "Him" en �5.719 segundos y ganas �988�12 puntos [01:28] Libelula\SinRespeto
�Absolutamente correcto Hipopotamo\Eficiente!! Acertaste "Him" en �5.719 segundos y ganas �988�12 puntos
[01:28] Libelula\SinRespeto ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points [01:28] Libelula\SinRespeto
ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points
[01:28] Libelula\SinRespeto Hipopotamo\Eficiente has acertado 5 seguidas!! Puntos HOY: 63030, SEMANA: 3467888 y MES: 3467888 [01:28] Libelula\SinRespeto
Hipopotamo\Eficiente has acertado 5 seguidas!! Puntos HOY: 63030, SEMANA: 3467888 y MES: 3467888
[01:28] Libelula\SinRespeto R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0 [01:28] Libelula\SinRespeto
R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0
[01:28] Libelula\SinRespeto Tri.10624 Medicina-Saludɐadcarras˿Elhmanguitordehloshrotadoreshsehencuentrabenael...w?w [01:28] Libelula\SinRespeto
Tri.10624 Medicina-Saludɐadcarras˿Elhmanguitordehloshrotadoreshsehencuentrabenael...w?w
[01:28] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 12382 Puntos [01:28] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 12382 Puntos
[01:29] Libelula\SinRespeto 2 Pista: hom*** 30 segundos y 12382 Puntos [01:29] Libelula\SinRespeto
2 Pista: hom*** 30 segundos y 12382 Puntos
[01:29] Hipopotamo\Eficiente Hombre [01:29] Hipopotamo\Eficiente
Hombre
[01:29] Libelula\SinRespeto 3 Pista: hom**o 15 segundos y 12382 Puntos [01:29] Libelula\SinRespeto
3 Pista: hom**o 15 segundos y 12382 Puntos
[01:29] Hipopotamo\Eficiente Hombro [01:29] Hipopotamo\Eficiente
Hombro
[01:29] Libelula\SinRespeto �Muy bien Hipopotamo\Eficiente!! Acertaste "Hombro" en tan s󬯠�0.953 segundos y por eso has ganado: �2382�12 puntos [01:29] Libelula\SinRespeto
�Muy bien Hipopotamo\Eficiente!! Acertaste "Hombro" en tan s󬯠�0.953 segundos y por eso has ganado: �2382�12 puntos
[01:29] Libelula\SinRespeto ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points [01:29] Libelula\SinRespeto
ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points
[01:29] Libelula\SinRespeto Hipopotamo\Eficiente has acertado 6 seguidas!! Puntos HOY: 75412, SEMANA: 3480270 y MES: 3480270 [01:29] Libelula\SinRespeto
Hipopotamo\Eficiente has acertado 6 seguidas!! Puntos HOY: 75412, SEMANA: 3480270 y MES: 3480270
[01:29] Libelula\SinRespeto For The Competitive Edge type !pingme [01:29] Libelula\SinRespeto
For The Competitive Edge type !pingme
[01:29] Libelula\SinRespeto Tri.594 Informaticaɢart1˿CuantosnminutosntardofenhcopiardunhCDbdeo650bMBbsirtengofunadgrabadorad2X?b?b [01:29] Libelula\SinRespeto
Tri.594 Informaticaɢart1˿CuantosnminutosntardofenhcopiardunhCDbdeo650bMBbsirtengofunadgrabadorad2X?b?b
[01:29] Libelula\SinRespeto 1 Pista: ** Valor pregunta : 17795 Puntos [01:29] Libelula\SinRespeto
1 Pista: ** Valor pregunta : 17795 Puntos
[01:29] Hipopotamo\Eficiente 15 [01:29] Hipopotamo\Eficiente
15
[01:29] Hipopotamo\Eficiente 16 [01:29] Hipopotamo\Eficiente
16
[01:30] Hipopotamo\Eficiente 28 [01:30] Hipopotamo\Eficiente
28
[01:30] Libelula\SinRespeto 2 Pista: 35 30 segundos y 17795 Puntos [01:30] Libelula\SinRespeto
2 Pista: 35 30 segundos y 17795 Puntos
[01:30] Hipopotamo\Eficiente 25 [01:30] Hipopotamo\Eficiente
25
[01:30] Hipopotamo\Eficiente 35 [01:30] Hipopotamo\Eficiente
35
[01:30] Libelula\SinRespeto �Enhorabuena Hipopotamo\Eficiente!! Has contestado "35" y por ello has ganado �7795�12 puntos [01:30] Libelula\SinRespeto
�Enhorabuena Hipopotamo\Eficiente!! Has contestado "35" y por ello has ganado �7795�12 puntos
[01:30] Libelula\SinRespeto ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points [01:30] Libelula\SinRespeto
ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points
[01:30] Libelula\SinRespeto Hipopotamo\Eficiente has acertado 7 seguidas!! Puntos HOY: 93207, SEMANA: 3498065 y MES: 3498065 [01:30] Libelula\SinRespeto
Hipopotamo\Eficiente has acertado 7 seguidas!! Puntos HOY: 93207, SEMANA: 3498065 y MES: 3498065
[01:30] Libelula\SinRespeto Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [01:30] Libelula\SinRespeto
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[01:30] Libelula\SinRespeto Tri.14007 Cotilleo-TVɔruchi˿Elmdise񡤯roPacojRabannesseshaqcaracterizadojporousaroennsuskmodelos...p?p [01:30] Libelula\SinRespeto
Tri.14007 Cotilleo-TVɔruchi˿Elmdise񡤯roPacojRabannesseshaqcaracterizadojporousaroennsuskmodelos...p?p
[01:30] Libelula\SinRespeto 1 Pista: ***** Valor pregunta : 17533 Puntos [01:30] Libelula\SinRespeto
1 Pista: ***** Valor pregunta : 17533 Puntos
[01:30] Libelula\SinRespeto 2 Pista: met** 30 segundos y 17533 Puntos [01:30] Libelula\SinRespeto
2 Pista: met** 30 segundos y 17533 Puntos
[01:30] Libelula\SinRespeto 3 Pista: meta* 15 segundos y 17533 Puntos [01:30] Libelula\SinRespeto
3 Pista: meta* 15 segundos y 17533 Puntos
[01:30] Libelula\SinRespeto �emuestra lo que sabes Hipopotamo\Eficiente! Has respondido "Metal" correctamente y eso te da: �7533�12 puntos [01:30] Libelula\SinRespeto
�emuestra lo que sabes Hipopotamo\Eficiente! Has respondido "Metal" correctamente y eso te da: �7533�12 puntos
[01:30] Libelula\SinRespeto ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points [01:30] Libelula\SinRespeto
ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points
[01:30] Libelula\SinRespeto Hipopotamo\Eficiente has acertado 8 seguidas!! Puntos HOY: 110740, SEMANA: 3515598 y MES: 3515598 [01:30] Libelula\SinRespeto
Hipopotamo\Eficiente has acertado 8 seguidas!! Puntos HOY: 110740, SEMANA: 3515598 y MES: 3515598
[01:30] Hipopotamo\Eficiente Metal [01:30] Hipopotamo\Eficiente
Metal
[01:31] Libelula\SinRespeto R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 14117436 #4: Cocodrilo-ConPrisa 13963595 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3498065 #9: LaCamelia 3029384 #10: Karen 1224969 [01:31] Libelula\SinRespeto
R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 14117436 #4: Cocodrilo-ConPrisa 13963595 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3498065 #9: LaCamelia 3029384 #10: Karen 1224969
[01:31] Libelula\SinRespeto Tri.2668 Idiomasɳorgo˿CHINO-ESPAяL:eHUANG?e?e [01:31] Libelula\SinRespeto
Tri.2668 Idiomasɳorgo˿CHINO-ESPAяL:eHUANG?e?e
[01:31] Libelula\SinRespeto 1 Pista: ******** Valor pregunta : 17495 Puntos [01:31] Libelula\SinRespeto
1 Pista: ******** Valor pregunta : 17495 Puntos
[01:31] Libelula\SinRespeto 2 Pista: ama***** 30 segundos y 17495 Puntos [01:31] Libelula\SinRespeto
2 Pista: ama***** 30 segundos y 17495 Puntos
[01:31] Libelula\SinRespeto �Increible!! Hipopotamo\Eficiente contest󺠃04"Amarillo" en �7.203 segundos, y ha ganado �7495�12 puntos [01:31] Libelula\SinRespeto
�Increible!! Hipopotamo\Eficiente contest󺠃04"Amarillo" en �7.203 segundos, y ha ganado �7495�12 puntos
[01:31] Libelula\SinRespeto ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points [01:31] Libelula\SinRespeto
ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points
[01:31] Libelula\SinRespeto Hipopotamo\Eficiente has acertado 9 seguidas!! Puntos HOY: 128235, SEMANA: 3533093 y MES: 3533093 [01:31] Libelula\SinRespeto
Hipopotamo\Eficiente has acertado 9 seguidas!! Puntos HOY: 128235, SEMANA: 3533093 y MES: 3533093
[01:31] Hipopotamo\Eficiente Amarillo [01:31] Hipopotamo\Eficiente
Amarillo
[01:31] Libelula\SinRespeto Please refrain from using Extreme Bad Language [01:31] Libelula\SinRespeto
Please refrain from using Extreme Bad Language
[01:31] Libelula\SinRespeto Tri.13132 Idiomasɦlipp_er˿ESPAяL--->ITALIANO:lunesj?t [01:31] Libelula\SinRespeto
Tri.13132 Idiomasɦlipp_er˿ESPAяL--->ITALIANO:lunesj?t
[01:31] Libelula\SinRespeto 1 Pista: ****** Pregunta de BONUS : 50000 Puntos [01:31] Libelula\SinRespeto
1 Pista: ****** Pregunta de BONUS : 50000 Puntos
[01:32] Libelula\SinRespeto 2 Pista: lun*** 30 segundos y 50000 Puntos [01:32] Libelula\SinRespeto
2 Pista: lun*** 30 segundos y 50000 Puntos
[01:32] Hipopotamo\Eficiente Luneli [01:32] Hipopotamo\Eficiente
Luneli
[01:32] Libelula\SinRespeto 3 Pista: lune*i 15 segundos y 50000 Puntos [01:32] Libelula\SinRespeto
3 Pista: lune*i 15 segundos y 50000 Puntos
[01:32] Hipopotamo\Eficiente Luneli [01:32] Hipopotamo\Eficiente
Luneli
[01:32] Libelula\SinRespeto �Absolutamente correcto Hipopotamo\Eficiente!! Acertaste "Lunedi" en �5.031 segundos y ganas �0000�12 puntos [01:32] Libelula\SinRespeto
�Absolutamente correcto Hipopotamo\Eficiente!! Acertaste "Lunedi" en �5.031 segundos y ganas �0000�12 puntos
[01:32] Libelula\SinRespeto ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points [01:32] Libelula\SinRespeto
ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points
[01:32] Libelula\SinRespeto Hipopotamo\Eficiente has acertado 10 seguidas!! Puntos HOY: 178235, SEMANA: 3583093 y MES: 3583093 [01:32] Libelula\SinRespeto
Hipopotamo\Eficiente has acertado 10 seguidas!! Puntos HOY: 178235, SEMANA: 3583093 y MES: 3583093
[01:32] Libelula\SinRespeto Bonus especial de 50000 Puntos para Hipopotamo\Eficiente por acertar 10 seguidas!!! [01:32] Libelula\SinRespeto
Bonus especial de 50000 Puntos para Hipopotamo\Eficiente por acertar 10 seguidas!!!
[01:32] Hipopotamo\Eficiente Lunedi [01:32] Hipopotamo\Eficiente
Lunedi
[01:32] Libelula\SinRespeto This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto [01:32] Libelula\SinRespeto
This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto
[01:32] Libelula\SinRespeto Tri.9762 MitologiaɔeLaRaNhA˿Egiptologia:ehijohdeeShuayudeeTefnut,eesposohdeeNutayupadreedeeOsiris,eIsis,eSethuyuNeftiso?e [01:32] Libelula\SinRespeto
Tri.9762 MitologiaɔeLaRaNhA˿Egiptologia:ehijohdeeShuayudeeTefnut,eesposohdeeNutayupadreedeeOsiris,eIsis,eSethuyuNeftiso?e
[01:32] Libelula\SinRespeto 1 Pista: **** Valor pregunta : 15196 Puntos [01:32] Libelula\SinRespeto
1 Pista: **** Valor pregunta : 15196 Puntos
[01:33] Libelula\SinRespeto 2 Pista: ghe* 30 segundos y 15196 Puntos [01:33] Libelula\SinRespeto
2 Pista: ghe* 30 segundos y 15196 Puntos
[01:33] Libelula\SinRespeto 3 Pista: ghe* 15 segundos y 15196 Puntos [01:33] Libelula\SinRespeto
3 Pista: ghe* 15 segundos y 15196 Puntos
[01:33] Hipopotamo\Eficiente Ghet [01:33] Hipopotamo\Eficiente
Ghet
[01:33] Hipopotamo\Eficiente Gher [01:33] Hipopotamo\Eficiente
Gher
[01:33] Libelula\SinRespeto Tiempo! La respuesta es -> gheb <- [01:33] Libelula\SinRespeto
Tiempo! La respuesta es -> gheb <-
[01:33] Hipopotamo\Eficiente Ghen [01:33] Hipopotamo\Eficiente
Ghen
[01:33] Libelula\SinRespeto This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 552740 #19: karen-62 535210 #20: Carlos_55 468075 [01:33] Libelula\SinRespeto
This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 552740 #19: karen-62 535210 #20: Carlos_55 468075
[01:33] Libelula\SinRespeto Tri.4759 Medicina-Saludɴamzarian˿Cuᬃ01iesselihuesoum᳃01sgrandesdelipie?t?t [01:33] Libelula\SinRespeto
Tri.4759 Medicina-Saludɴamzarian˿Cuᬃ01iesselihuesoum᳃01sgrandesdelipie?t?t
[01:33] Libelula\SinRespeto 1 Pista: ******** Valor pregunta : 14235 Puntos [01:33] Libelula\SinRespeto
1 Pista: ******** Valor pregunta : 14235 Puntos
[01:33] Libelula\SinRespeto 2 Pista: cal***** 30 segundos y 14235 Puntos [01:33] Libelula\SinRespeto
2 Pista: cal***** 30 segundos y 14235 Puntos
[01:34] Libelula\SinRespeto 3 Pista: cal*a*eo 15 segundos y 14235 Puntos [01:34] Libelula\SinRespeto
3 Pista: cal*a*eo 15 segundos y 14235 Puntos
[01:34] Libelula\SinRespeto Tiempo! La respuesta es -> calcaneo <- [01:34] Libelula\SinRespeto
Tiempo! La respuesta es -> calcaneo <-
[01:34] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [01:34] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[01:34] Libelula\SinRespeto Tri.9697 Arteɍento˿Dondelestჰ1plamIglesiamdelSanqDonatokyvelnPalaciokdelSanqGiorgiok?p [01:34] Libelula\SinRespeto
Tri.9697 Arteɍento˿Dondelestჰ1plamIglesiamdelSanqDonatokyvelnPalaciokdelSanqGiorgiok?p
[01:34] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 10453 Puntos [01:34] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 10453 Puntos
[01:34] Libelula\SinRespeto 2 Pista: gen*** 30 segundos y 10453 Puntos [01:34] Libelula\SinRespeto
2 Pista: gen*** 30 segundos y 10453 Puntos
[01:35] Libelula\SinRespeto 3 Pista: geno*a 15 segundos y 10453 Puntos [01:35] Libelula\SinRespeto
3 Pista: geno*a 15 segundos y 10453 Puntos
[01:35] Libelula\SinRespeto Tiempo! La respuesta es -> genova <- [01:35] Libelula\SinRespeto
Tiempo! La respuesta es -> genova <-
[01:35] Libelula\SinRespeto This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 559604 #15: Aguila-Especial 543035 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704 [01:35] Libelula\SinRespeto
This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 559604 #15: Aguila-Especial 543035 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704
[01:35] Libelula\SinRespeto Tri.13367 Economiaɓebosin˿Cuᬃ01aesqelanombreudeulasciudadfmallorquinasconwafamadasqperlasqartificiales?d?d [01:35] Libelula\SinRespeto
Tri.13367 Economiaɓebosin˿Cuᬃ01aesqelanombreudeulasciudadfmallorquinasconwafamadasqperlasqartificiales?d?d
[01:35] Libelula\SinRespeto 1 Pista: ******* Valor pregunta : 22386 Puntos [01:35] Libelula\SinRespeto
1 Pista: ******* Valor pregunta : 22386 Puntos
[01:35] Libelula\SinRespeto 2 Pista: man**** 30 segundos y 22386 Puntos [01:35] Libelula\SinRespeto
2 Pista: man**** 30 segundos y 22386 Puntos
[01:36] Libelula\SinRespeto 3 Pista: mana*o* 15 segundos y 22386 Puntos [01:36] Libelula\SinRespeto
3 Pista: mana*o* 15 segundos y 22386 Puntos
[01:36] Libelula\SinRespeto Tiempo! La respuesta es -> manacor <- [01:36] Libelula\SinRespeto
Tiempo! La respuesta es -> manacor <-
[01:36] Libelula\SinRespeto R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0 [01:36] Libelula\SinRespeto
R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0
[01:36] Libelula\SinRespeto Tri.9709 Cineɬusie˿Directorwdeg"LamcostillamdegAdᮢp(1949)"p?p [01:36] Libelula\SinRespeto
Tri.9709 Cineɬusie˿Directorwdeg"LamcostillamdegAdᮢp(1949)"p?p
[01:36] Libelula\SinRespeto 1 Pista: ****** ***** Valor pregunta : 23852 Puntos [01:36] Libelula\SinRespeto
1 Pista: ****** ***** Valor pregunta : 23852 Puntos
[01:36] Libelula\SinRespeto 2 Pista: geo*** ***** 30 segundos y 23852 Puntos [01:36] Libelula\SinRespeto
2 Pista: geo*** ***** 30 segundos y 23852 Puntos
[01:37] Libelula\SinRespeto 3 Pista: geo**e *u*o* 15 segundos y 23852 Puntos [01:37] Libelula\SinRespeto
3 Pista: geo**e *u*o* 15 segundos y 23852 Puntos
[01:37] Libelula\SinRespeto Tiempo! La respuesta es -> george�ukor <- [01:37] Libelula\SinRespeto
Tiempo! La respuesta es -> george�ukor <-
[01:37] Libelula\SinRespeto Top10 Players ( Weekly & Monthly ) are Auto-Voiced [01:37] Libelula\SinRespeto
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[01:37] Libelula\SinRespeto Tri.18084 Biologiaɴjmm.com˿Elkᣩdorsalic�co,horigenlderlajaspirina,hserobten�01jderlajcortezajderqu郰1hᲢolk(querantesbserusabajenlinfusi󮩃01h?h [01:37] Libelula\SinRespeto
Tri.18084 Biologiaɴjmm.com˿Elkᣩdorsalic�co,horigenlderlajaspirina,hserobten�01jderlajcortezajderqu郰1hᲢolk(querantesbserusabajenlinfusi󮩃01h?h
[01:37] Libelula\SinRespeto 1 Pista: ***** Valor pregunta : 12580 Puntos [01:37] Libelula\SinRespeto
1 Pista: ***** Valor pregunta : 12580 Puntos
[01:37] Libelula\SinRespeto 2 Pista: sau** 30 segundos y 12580 Puntos [01:37] Libelula\SinRespeto
2 Pista: sau** 30 segundos y 12580 Puntos
[01:37] Libelula\SinRespeto 3 Pista: sau*e 15 segundos y 12580 Puntos [01:37] Libelula\SinRespeto
3 Pista: sau*e 15 segundos y 12580 Puntos
[01:38] Culebra}Agil Sauce [01:38] Culebra}Agil
Sauce
[01:38] Libelula\SinRespeto �Bien Culebra}Agil!! Tu respuesta: "Sauce" es correcta y ganas �2580�12 puntos [01:38] Libelula\SinRespeto
�Bien Culebra}Agil!! Tu respuesta: "Sauce" es correcta y ganas �2580�12 puntos
[01:38] Libelula\SinRespeto ACTION awards Culebra}Agil with a +v for having over 15000 points [01:38] Libelula\SinRespeto
ACTION awards Culebra}Agil with a +v for having over 15000 points
[01:38] Libelula\SinRespeto Culebra}Agil has acertado 1 seguidas!! Puntos HOY: 12580, SEMANA: 10731654 y MES: 572184 [01:38] Libelula\SinRespeto
Culebra}Agil has acertado 1 seguidas!! Puntos HOY: 12580, SEMANA: 10731654 y MES: 572184
[01:38] Libelula\SinRespeto Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [01:38] Libelula\SinRespeto
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[01:38] Libelula\SinRespeto Tri.12634 BiologiaɞIrati˿C󭯃01lsesllamanelosyhongosycapacesydesfermentarrlosyaz�caresyyiproducirralcoholedurantesesesproceso?s?s [01:38] Libelula\SinRespeto
Tri.12634 BiologiaɞIrati˿C󭯃01lsesllamanelosyhongosycapacesydesfermentarrlosyaz�caresyyiproducirralcoholedurantesesesproceso?s?s
[01:38] Libelula\SinRespeto 1 Pista: ********* Valor pregunta : 15910 Puntos [01:38] Libelula\SinRespeto
1 Pista: ********* Valor pregunta : 15910 Puntos
[01:38] Libelula\SinRespeto 2 Pista: lev****** 30 segundos y 15910 Puntos [01:38] Libelula\SinRespeto
2 Pista: lev****** 30 segundos y 15910 Puntos
[01:38] Hipopotamo\Eficiente Levadura [01:38] Hipopotamo\Eficiente
Levadura
[01:38] Libelula\SinRespeto �Muy bien Hipopotamo\Eficiente!! Acertaste "Levaduras" en tan s󬯠�1.312 segundos y por eso has ganado: �5910�12 puntos [01:38] Libelula\SinRespeto
�Muy bien Hipopotamo\Eficiente!! Acertaste "Levaduras" en tan s󬯠�1.312 segundos y por eso has ganado: �5910�12 puntos
[01:38] Libelula\SinRespeto ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points [01:38] Libelula\SinRespeto
ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points
[01:38] Libelula\SinRespeto Hipopotamo\Eficiente has acertado 1 seguidas!! Puntos HOY: 244145, SEMANA: 3649003 y MES: 3649003 [01:38] Libelula\SinRespeto
Hipopotamo\Eficiente has acertado 1 seguidas!! Puntos HOY: 244145, SEMANA: 3649003 y MES: 3649003
[01:38] Hipopotamo\Eficiente Levaduras [01:38] Hipopotamo\Eficiente
Levaduras
[01:38] Libelula\SinRespeto R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 17788999 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 13963595 #5: Culebra}Agil 10731654 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3649003 [01:38] Libelula\SinRespeto
R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 17788999 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 13963595 #5: Culebra}Agil 10731654 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3649003
[01:38] Libelula\SinRespeto Tri.12974 Medicina-Saludɬusie˅ldcuerpoihumano:s߃󭯃01iseillamanwlospm�sculospqueihacenwgirarqlatmu񥣡tyslatmano?s?s [01:38] Libelula\SinRespeto
Tri.12974 Medicina-Saludɬusie˅ldcuerpoihumano:s߃󭯃01iseillamanwlospm�sculospqueihacenwgirarqlatmu񥣡tyslatmano?s?s
[01:38] Libelula\SinRespeto 1 Pista: *** ********** * *********** Valor pregunta : 11377 Puntos [01:38] Libelula\SinRespeto
1 Pista: *** ********** * *********** Valor pregunta : 11377 Puntos
[01:39] Libelula\SinRespeto 2 Pista: los ********** * *********** 30 segundos y 11377 Puntos [01:39] Libelula\SinRespeto
2 Pista: los ********** * *********** 30 segundos y 11377 Puntos
[01:39] Libelula\SinRespeto 3 Pista: los **o*a*o*e* * *u*i*a*o*e* 15 segundos y 11377 Puntos [01:39] Libelula\SinRespeto
3 Pista: los **o*a*o*e* * *u*i*a*o*e* 15 segundos y 11377 Puntos
[01:39] Libelula\SinRespeto Tiempo! La respuesta es -> los�ronadores��upinadores <- [01:39] Libelula\SinRespeto
Tiempo! La respuesta es -> los�ronadores��upinadores <-
[01:39] Libelula\SinRespeto We feature over 50,000 Q&A ! [01:39] Libelula\SinRespeto
We feature over 50,000 Q&A !
[01:39] Libelula\SinRespeto Tri.12446 Personajesɑuim˿Enzqu郰1jciudadunaci󃰱jBenitovP鲥zjGald󳃰1k?j [01:39] Libelula\SinRespeto
Tri.12446 Personajesɑuim˿Enzqu郰1jciudadunaci󃰱jBenitovP鲥zjGald󳃰1k?j
[01:39] Libelula\SinRespeto 1 Pista: *** ****** Valor pregunta : 22570 Puntos [01:39] Libelula\SinRespeto
1 Pista: *** ****** Valor pregunta : 22570 Puntos
[01:39] Libelula\SinRespeto 2 Pista: las ****** 30 segundos y 22570 Puntos [01:39] Libelula\SinRespeto
2 Pista: las ****** 30 segundos y 22570 Puntos
[01:40] Libelula\SinRespeto 3 Pista: las *a**a* 15 segundos y 22570 Puntos [01:40] Libelula\SinRespeto
3 Pista: las *a**a* 15 segundos y 22570 Puntos
[01:40] Libelula\SinRespeto Tiempo! La respuesta es -> las�almas <- [01:40] Libelula\SinRespeto
Tiempo! La respuesta es -> las�almas <-
[01:40] Libelula\SinRespeto Tri.5869 Eros-SexɁntiquo˿C󭯃01gsejdenominawaljpuntogdejmḩmawexcitaci󮿃01i?i [01:40] Libelula\SinRespeto
Tri.5869 Eros-SexɁntiquo˿C󭯃01gsejdenominawaljpuntogdejmḩmawexcitaci󮿃01i?i
[01:40] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 6646 Puntos [01:40] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 6646 Puntos
[01:40] Libelula\SinRespeto 2 Pista: cli*** 30 segundos y 6646 Puntos [01:40] Libelula\SinRespeto
2 Pista: cli*** 30 segundos y 6646 Puntos
[01:40] Libelula\SinRespeto �Est᳠que lo tiras Hipopotamo\Eficiente!! ߃󭯠supiste que "Climax" era la respuesta? Venga, �646�12 puntos suben a tu marcador [01:40] Libelula\SinRespeto
�Est᳠que lo tiras Hipopotamo\Eficiente!! ߃󭯠supiste que "Climax" era la respuesta? Venga, �646�12 puntos suben a tu marcador
[01:40] Libelula\SinRespeto ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points [01:40] Libelula\SinRespeto
ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points
[01:40] Libelula\SinRespeto Hipopotamo\Eficiente has acertado 2 seguidas!! Puntos HOY: 250791, SEMANA: 3655649 y MES: 3655649 [01:40] Libelula\SinRespeto
Hipopotamo\Eficiente has acertado 2 seguidas!! Puntos HOY: 250791, SEMANA: 3655649 y MES: 3655649
[01:40] Hipopotamo\Eficiente Climax [01:40] Hipopotamo\Eficiente
Climax
[01:41] Libelula\SinRespeto Tri.3478 Cotilleo-TVɓESINO˿(ThepSimpsons)s߃omozmuriozbolabdepnieve,sprimerwgatozdeplosqsimpsonsq?s [01:41] Libelula\SinRespeto
Tri.3478 Cotilleo-TVɓESINO˿(ThepSimpsons)s߃omozmuriozbolabdepnieve,sprimerwgatozdeplosqsimpsonsq?s
[01:41] Libelula\SinRespeto 1 Pista: *********** *** ** ***** Valor pregunta : 6528 Puntos [01:41] Libelula\SinRespeto
1 Pista: *********** *** ** ***** Valor pregunta : 6528 Puntos
[01:41] Libelula\SinRespeto 2 Pista: atr******** *** ** ***** 30 segundos y 6528 Puntos [01:41] Libelula\SinRespeto
2 Pista: atr******** *** ** ***** 30 segundos y 6528 Puntos
[01:41] Libelula\SinRespeto 3 Pista: atro*e**a*o *o* u* *o**e 15 segundos y 6528 Puntos [01:41] Libelula\SinRespeto
3 Pista: atro*e**a*o *o* u* *o**e 15 segundos y 6528 Puntos
[01:41] Libelula\SinRespeto Tiempo! La respuesta es -> atropellado�or�n�oche <- [01:41] Libelula\SinRespeto
Tiempo! La respuesta es -> atropellado�or�n�oche <-
[01:42] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [01:42] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[01:42] Libelula\SinRespeto Tri.12057 Geografiaɭartuniki˿ENyQUEyCORDILLERAyESTAyELyMUZTAGy?y [01:42] Libelula\SinRespeto
Tri.12057 Geografiaɭartuniki˿ENyQUEyCORDILLERAyESTAyELyMUZTAGy?y
[01:42] Libelula\SinRespeto 1 Pista: ***** **** Valor pregunta : 9538 Puntos [01:42] Libelula\SinRespeto
1 Pista: ***** **** Valor pregunta : 9538 Puntos
[01:42] Libelula\SinRespeto 2 Pista: kul** **** 30 segundos y 9538 Puntos [01:42] Libelula\SinRespeto
2 Pista: kul** **** 30 segundos y 9538 Puntos
[01:42] Libelula\SinRespeto 3 Pista: kulu* **a* 15 segundos y 9538 Puntos [01:42] Libelula\SinRespeto
3 Pista: kulu* **a* 15 segundos y 9538 Puntos
[01:42] Libelula\SinRespeto Tiempo! La respuesta es -> kulun�han <- [01:42] Libelula\SinRespeto
Tiempo! La respuesta es -> kulun�han <-
[01:42] Libelula\SinRespeto R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0 [01:42] Libelula\SinRespeto
R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0
[01:42] Libelula\SinRespeto Tri.10176 LiteraturaɃHESARE˿AUTORdDEdLEYENDASdCOMOdRAYOdDEdLUNA...d?d [01:42] Libelula\SinRespeto
Tri.10176 LiteraturaɃHESARE˿AUTORdDEdLEYENDASdCOMOdRAYOdDEdLUNA...d?d
[01:42] Libelula\SinRespeto 1 Pista: ******* ****** ******* Valor pregunta : 11325 Puntos [01:42] Libelula\SinRespeto
1 Pista: ******* ****** ******* Valor pregunta : 11325 Puntos
[01:43] Libelula\SinRespeto 2 Pista: gus**** ****** ******* 30 segundos y 11325 Puntos [01:43] Libelula\SinRespeto
2 Pista: gus**** ****** ******* 30 segundos y 11325 Puntos
[01:43] Libelula\SinRespeto 3 Pista: gus*a*o a*o**o *e**ue* 15 segundos y 11325 Puntos [01:43] Libelula\SinRespeto
3 Pista: gus*a*o a*o**o *e**ue* 15 segundos y 11325 Puntos
[01:43] Libelula\SinRespeto Tiempo! La respuesta es -> gustavo�dolfo�ecquer <- [01:43] Libelula\SinRespeto
Tiempo! La respuesta es -> gustavo�dolfo�ecquer <-
[01:43] Libelula\SinRespeto If you think a Q&A is wrong, please call an OP [01:43] Libelula\SinRespeto
If you think a Q&A is wrong, please call an OP
[01:43] Libelula\SinRespeto Tri.19365 Cancionesɞdazzler^˿Desquienhesjelytemas'CaliforniasSun'v?v [01:43] Libelula\SinRespeto
Tri.19365 Cancionesɞdazzler^˿Desquienhesjelytemas'CaliforniasSun'v?v
[01:43] Libelula\SinRespeto 1 Pista: *** ******** Valor pregunta : 14351 Puntos [01:43] Libelula\SinRespeto
1 Pista: *** ******** Valor pregunta : 14351 Puntos
[01:44] Libelula\SinRespeto 2 Pista: the ******** 30 segundos y 14351 Puntos [01:44] Libelula\SinRespeto
2 Pista: the ******** 30 segundos y 14351 Puntos
[01:44] Libelula\SinRespeto 3 Pista: the *i*ie*a* 15 segundos y 14351 Puntos [01:44] Libelula\SinRespeto
3 Pista: the *i*ie*a* 15 segundos y 14351 Puntos
[01:44] Libelula\SinRespeto Tiempo! La respuesta es -> the�ivieras <- [01:44] Libelula\SinRespeto
Tiempo! La respuesta es -> the�ivieras <-
[01:44] Libelula\SinRespeto R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0 [01:44] Libelula\SinRespeto
R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0
[01:44] Libelula\SinRespeto Tri.4741 Geografiaɓebosin˿CuᬥshsonilashcuatrofprovinciashdelCerde񡿃01q?q [01:44] Libelula\SinRespeto
Tri.4741 Geografiaɓebosin˿CuᬥshsonilashcuatrofprovinciashdelCerde񡿃01q?q
[01:44] Libelula\SinRespeto 1 Pista: ******** ***** ******** * ******* Valor pregunta : 22700 Puntos [01:44] Libelula\SinRespeto
1 Pista: ******** ***** ******** * ******* Valor pregunta : 22700 Puntos
[01:45] Libelula\SinRespeto 2 Pista: cag***** ***** ******** * ******* 30 segundos y 22700 Puntos [01:45] Libelula\SinRespeto
2 Pista: cag***** ***** ******** * ******* 30 segundos y 22700 Puntos
[01:45] Libelula\SinRespeto 3 Pista: cag*ia*i *uo*o o*i**a*o * *a**a*i 15 segundos y 22700 Puntos [01:45] Libelula\SinRespeto
3 Pista: cag*ia*i *uo*o o*i**a*o * *a**a*i 15 segundos y 22700 Puntos
[01:45] Libelula\SinRespeto Tiempo! La respuesta es -> cagliari�uoro�ristano��assari <- [01:45] Libelula\SinRespeto
Tiempo! La respuesta es -> cagliari�uoro�ristano��assari <-
[01:45] Libelula\SinRespeto For The Competitive Edge type !pingme [01:45] Libelula\SinRespeto
For The Competitive Edge type !pingme
[01:45] Libelula\SinRespeto Tri.1156 HistoriaɊAVEA˿DONDEySEyREFUGIOyELyJEFEyDEyESTADOyDEyPANAMAyPARAyINTENTARyHUIRyDELyEJERCITOyDEyEE.UUyQUEyINVADIOySUyPAISyPARAyCAPTURARLOy?y [01:45] Libelula\SinRespeto
Tri.1156 HistoriaɊAVEA˿DONDEySEyREFUGIOyELyJEFEyDEyESTADOyDEyPANAMAyPARAyINTENTARyHUIRyDELyEJERCITOyDEyEE.UUyQUEyINVADIOySUyPAISyPARAyCAPTURARLOy?y
[01:45] Libelula\SinRespeto 1 Pista: ** ** ********** ********** Valor pregunta : 7275 Puntos [01:45] Libelula\SinRespeto
1 Pista: ** ** ********** ********** Valor pregunta : 7275 Puntos
[01:46] Libelula\SinRespeto 2 Pista: EN�* ********** ********** 30 segundos y 7275 Puntos [01:46] Libelula\SinRespeto
2 Pista: EN�* ********** ********** 30 segundos y 7275 Puntos
[01:46] Libelula\SinRespeto 3 Pista: EN�A *U**IA*U*A A*O**O*I*A 15 segundos y 7275 Puntos [01:46] Libelula\SinRespeto
3 Pista: EN�A *U**IA*U*A A*O**O*I*A 15 segundos y 7275 Puntos
[01:46] LeonConPereza Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas [01:46] LeonConPereza
Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas
[01:46] Libelula\SinRespeto Tiempo! La respuesta es -> EN�A�UNCIATURA�POSTOLICA <- [01:46] Libelula\SinRespeto
Tiempo! La respuesta es -> EN�A�UNCIATURA�POSTOLICA <-
[01:46] Libelula\SinRespeto Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [01:46] Libelula\SinRespeto
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[01:46] Libelula\SinRespeto Tri.10777 Musicaɂruce˿Enequ郰1iislayvivelMikelOldfieldn?i [01:46] Libelula\SinRespeto
Tri.10777 Musicaɂruce˿Enequ郰1iislayvivelMikelOldfieldn?i
[01:46] Libelula\SinRespeto 1 Pista: ***** Valor pregunta : 8462 Puntos [01:46] Libelula\SinRespeto
1 Pista: ***** Valor pregunta : 8462 Puntos
[01:46] Libelula\SinRespeto 2 Pista: ibi** 30 segundos y 8462 Puntos [01:46] Libelula\SinRespeto
2 Pista: ibi** 30 segundos y 8462 Puntos
[01:47] Libelula\SinRespeto 3 Pista: ibi*a 15 segundos y 8462 Puntos [01:47] Libelula\SinRespeto
3 Pista: ibi*a 15 segundos y 8462 Puntos
[01:47] Libelula\SinRespeto Tiempo! La respuesta es -> ibiza <- [01:47] Libelula\SinRespeto
Tiempo! La respuesta es -> ibiza <-
[01:47] Libelula\SinRespeto R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 14117436 #4: Cocodrilo-ConPrisa 13963595 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3655649 #9: LaCamelia 3029384 #10: Karen 1224969 [01:47] Libelula\SinRespeto
R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 14117436 #4: Cocodrilo-ConPrisa 13963595 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3655649 #9: LaCamelia 3029384 #10: Karen 1224969
[01:47] Libelula\SinRespeto Tri.3983 Personajesɳorgo˿ENeQUɃ01eLOCALIDADeCONQUENSEeNACIOeFRAYeLUISeDEeLEON?e?e [01:47] Libelula\SinRespeto
Tri.3983 Personajesɳorgo˿ENeQUɃ01eLOCALIDADeCONQUENSEeNACIOeFRAYeLUISeDEeLEON?e?e
[01:47] Libelula\SinRespeto 1 Pista: ******** Valor pregunta : 14612 Puntos [01:47] Libelula\SinRespeto
1 Pista: ******** Valor pregunta : 14612 Puntos
[01:47] Libelula\SinRespeto 2 Pista: bel***** 30 segundos y 14612 Puntos [01:47] Libelula\SinRespeto
2 Pista: bel***** 30 segundos y 14612 Puntos
[01:48] Libelula\SinRespeto 3 Pista: bel*o**e 15 segundos y 14612 Puntos [01:48] Libelula\SinRespeto
3 Pista: bel*o**e 15 segundos y 14612 Puntos
[01:48] Libelula\SinRespeto Tiempo! La respuesta es -> belmonte <- [01:48] Libelula\SinRespeto
Tiempo! La respuesta es -> belmonte <-
[01:48] Libelula\SinRespeto Please refrain from using Extreme Bad Language [01:48] Libelula\SinRespeto
Please refrain from using Extreme Bad Language
[01:48] Libelula\SinRespeto Tri.7413 GastronomiaɁnghara˿Concharina,eleche,elevadura,emantequilla,eaz�car,esalaymaceitesencUSAehacenclossfamososs?e [01:48] Libelula\SinRespeto
Tri.7413 GastronomiaɁnghara˿Concharina,eleche,elevadura,emantequilla,eaz�car,esalaymaceitesencUSAehacenclossfamososs?e
[01:48] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 21786 Puntos [01:48] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 21786 Puntos
[01:49] Libelula\SinRespeto 2 Pista: don*** 30 segundos y 21786 Puntos [01:49] Libelula\SinRespeto
2 Pista: don*** 30 segundos y 21786 Puntos
[01:49] Libelula\SinRespeto 3 Pista: donu** 15 segundos y 21786 Puntos [01:49] Libelula\SinRespeto
3 Pista: donu** 15 segundos y 21786 Puntos
[01:49] Hipopotamo\Eficiente Donuts [01:49] Hipopotamo\Eficiente
Donuts
[01:49] Libelula\SinRespeto �Suma y sigue Hipopotamo\Eficiente!! La respuesta: "Donuts" incrementa tu marcador en �1786�12 puntos [01:49] Libelula\SinRespeto
�Suma y sigue Hipopotamo\Eficiente!! La respuesta: "Donuts" incrementa tu marcador en �1786�12 puntos
[01:49] Libelula\SinRespeto ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points [01:49] Libelula\SinRespeto
ACTION awards Hipopotamo\Eficiente with a +v for having over 15000 points
[01:49] Libelula\SinRespeto Hipopotamo\Eficiente has acertado 3 seguidas!! Puntos HOY: 272577, SEMANA: 3677435 y MES: 3677435 [01:49] Libelula\SinRespeto
Hipopotamo\Eficiente has acertado 3 seguidas!! Puntos HOY: 272577, SEMANA: 3677435 y MES: 3677435
[01:49] Libelula\SinRespeto This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto [01:49] Libelula\SinRespeto
This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto
[01:49] Libelula\SinRespeto Tri.8231 InformaticaɍARdeJAVA˿CӍOeSEeLLAMAeUNAeDEeLASeM�eCONOCIDASeENCICLOPEDIASePARAePCe(DEeMICROSOFT)?e?e [01:49] Libelula\SinRespeto
Tri.8231 InformaticaɍARdeJAVA˿CӍOeSEeLLAMAeUNAeDEeLASeM�eCONOCIDASeENCICLOPEDIASePARAePCe(DEeMICROSOFT)?e?e
[01:49] Libelula\SinRespeto 1 Pista: ******* Valor pregunta : 10377 Puntos [01:49] Libelula\SinRespeto
1 Pista: ******* Valor pregunta : 10377 Puntos
[01:49] Libelula\SinRespeto 2 Pista: enc**** 30 segundos y 10377 Puntos [01:49] Libelula\SinRespeto
2 Pista: enc**** 30 segundos y 10377 Puntos
[01:50] Libelula\SinRespeto 3 Pista: enca**a 15 segundos y 10377 Puntos [01:50] Libelula\SinRespeto
3 Pista: enca**a 15 segundos y 10377 Puntos
[01:50] Libelula\SinRespeto Tiempo! La respuesta es -> encarta <- [01:50] Libelula\SinRespeto
Tiempo! La respuesta es -> encarta <-
[01:50] Hipopotamo\Eficiente Encarta [01:50] Hipopotamo\Eficiente
Encarta
[01:50] Libelula\SinRespeto This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 552740 #19: karen-62 535210 #20: Carlos_55 468075 [01:50] Libelula\SinRespeto
This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 552740 #19: karen-62 535210 #20: Carlos_55 468075
[01:50] Libelula\SinRespeto Tri.19896 IdiomasɆrigotora˿Encingl鳃01cresultar?p?p [01:50] Libelula\SinRespeto
Tri.19896 IdiomasɆrigotora˿Encingl鳃01cresultar?p?p
[01:50] Libelula\SinRespeto 1 Pista: **** *** Pregunta de BONUS : 50000 Puntos [01:50] Libelula\SinRespeto
1 Pista: **** *** Pregunta de BONUS : 50000 Puntos
[01:50] Libelula\SinRespeto 2 Pista: tur* *** 30 segundos y 50000 Puntos [01:50] Libelula\SinRespeto
2 Pista: tur* *** 30 segundos y 50000 Puntos
[01:51] Libelula\SinRespeto 3 Pista: tur* ou* 15 segundos y 50000 Puntos [01:51] Libelula\SinRespeto
3 Pista: tur* ou* 15 segundos y 50000 Puntos
[01:51] Libelula\SinRespeto Tiempo! La respuesta es -> turn�ut <- [01:51] Libelula\SinRespeto
Tiempo! La respuesta es -> turn�ut <-
[01:51] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [01:51] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[01:51] Libelula\SinRespeto Tri.5956 Medicina-SaludɄRAKULL˿Cirug�uQu郰1useshacesparagunirslagves�lagbiliarsconqeloduodeno?u?u [01:51] Libelula\SinRespeto
Tri.5956 Medicina-SaludɄRAKULL˿Cirug�uQu郰1useshacesparagunirslagves�lagbiliarsconqeloduodeno?u?u
[01:51] Libelula\SinRespeto 1 Pista: ********************** Valor pregunta : 22449 Puntos [01:51] Libelula\SinRespeto
1 Pista: ********************** Valor pregunta : 22449 Puntos
[01:51] Libelula\SinRespeto 2 Pista: col******************* 30 segundos y 22449 Puntos [01:51] Libelula\SinRespeto
2 Pista: col******************* 30 segundos y 22449 Puntos
[01:51] Libelula\SinRespeto 3 Pista: cole*i**o*uo*e*o**o*ia 15 segundos y 22449 Puntos [01:51] Libelula\SinRespeto
3 Pista: cole*i**o*uo*e*o**o*ia 15 segundos y 22449 Puntos
[01:52] Libelula\SinRespeto Tiempo! La respuesta es -> colecistoduodenostomia <- [01:52] Libelula\SinRespeto
Tiempo! La respuesta es -> colecistoduodenostomia <-
[01:52] Libelula\SinRespeto This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 572184 #15: Aguila-Especial 543035 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704 [01:52] Libelula\SinRespeto
This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 572184 #15: Aguila-Especial 543035 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704
[01:52] Libelula\SinRespeto Tri.14788 Fisica-QuimicaɍaGo0˿ElementoxcuyoxsimboloxesqNet?g [01:52] Libelula\SinRespeto
Tri.14788 Fisica-QuimicaɍaGo0˿ElementoxcuyoxsimboloxesqNet?g
[01:52] Libelula\SinRespeto 1 Pista: **** Valor pregunta : 10076 Puntos [01:52] Libelula\SinRespeto
1 Pista: **** Valor pregunta : 10076 Puntos
[01:52] Libelula\SinRespeto 2 Pista: neo* 30 segundos y 10076 Puntos [01:52] Libelula\SinRespeto
2 Pista: neo* 30 segundos y 10076 Puntos
[01:52] Libelula\SinRespeto �Muy bien Aguila}Insufrible!! Acertaste "neon" en tan s󬯠�9.891 segundos y por eso has ganado: �0076�12 puntos [01:52] Libelula\SinRespeto
�Muy bien Aguila}Insufrible!! Acertaste "neon" en tan s󬯠�9.891 segundos y por eso has ganado: �0076�12 puntos
[01:52] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [01:52] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[01:52] Libelula\SinRespeto Aguila}Insufrible has acertado 1 seguidas!! Puntos HOY: 10076, SEMANA: 17799075 y MES: 14127512 [01:52] Libelula\SinRespeto
Aguila}Insufrible has acertado 1 seguidas!! Puntos HOY: 10076, SEMANA: 17799075 y MES: 14127512
[01:52] Aguila}Insufrible neon [01:52] Aguila}Insufrible
neon
[01:52] Libelula\SinRespeto R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0 [01:52] Libelula\SinRespeto
R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0
[01:52] Libelula\SinRespeto Tri.19640 MiscelaneaɎefthis˿ComoqsejllamazelblugarhdondejsejencuentranwlasnjoyasndejlazCoronazbritanica?j?j [01:52] Libelula\SinRespeto
Tri.19640 MiscelaneaɎefthis˿ComoqsejllamazelblugarhdondejsejencuentranwlasnjoyasndejlazCoronazbritanica?j?j
[01:52] Libelula\SinRespeto 1 Pista: ***** ** ******* Valor pregunta : 13392 Puntos [01:52] Libelula\SinRespeto
1 Pista: ***** ** ******* Valor pregunta : 13392 Puntos
[01:53] Libelula\SinRespeto 2 Pista: tor** ** ******* 30 segundos y 13392 Puntos [01:53] Libelula\SinRespeto
2 Pista: tor** ** ******* 30 segundos y 13392 Puntos
[01:53] Libelula\SinRespeto 3 Pista: tor*e *e *o***e* 15 segundos y 13392 Puntos [01:53] Libelula\SinRespeto
3 Pista: tor*e *e *o***e* 15 segundos y 13392 Puntos
[01:53] Libelula\SinRespeto Tiempo! La respuesta es -> torre�e�ondres <- [01:53] Libelula\SinRespeto
Tiempo! La respuesta es -> torre�e�ondres <-
[01:53] Libelula\SinRespeto Top10 Players ( Weekly & Monthly ) are Auto-Voiced [01:53] Libelula\SinRespeto
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[01:53] Libelula\SinRespeto Tri.13943 Personajesɭartuniki˿LUGARyDONDEyMURIOyVICENTEyBLASCOyiba񥺃01y?y [01:53] Libelula\SinRespeto
Tri.13943 Personajesɭartuniki˿LUGARyDONDEyMURIOyVICENTEyBLASCOyiba񥺃01y?y
[01:53] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 16439 Puntos [01:53] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 16439 Puntos
[01:54] Libelula\SinRespeto 2 Pista: men*** 30 segundos y 16439 Puntos [01:54] Libelula\SinRespeto
2 Pista: men*** 30 segundos y 16439 Puntos
[01:54] Libelula\SinRespeto 3 Pista: men*o* 15 segundos y 16439 Puntos [01:54] Libelula\SinRespeto
3 Pista: men*o* 15 segundos y 16439 Puntos
[01:54] Libelula\SinRespeto Tiempo! La respuesta es -> menton <- [01:54] Libelula\SinRespeto
Tiempo! La respuesta es -> menton <-
[01:54] Libelula\SinRespeto Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [01:54] Libelula\SinRespeto
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[01:54] Libelula\SinRespeto Tri.20753 Informaticaɧuardiann˿Cuᬃ01kesqelkentornovgrᦩcovequivalentehaywindowsqparaylinux?y?y [01:54] Libelula\SinRespeto
Tri.20753 Informaticaɧuardiann˿Cuᬃ01kesqelkentornovgrᦩcovequivalentehaywindowsqparaylinux?y?y
[01:54] Libelula\SinRespeto 1 Pista: *-******* Pregunta de BONUS : 25000 Puntos [01:54] Libelula\SinRespeto
1 Pista: *-******* Pregunta de BONUS : 25000 Puntos
[01:54] LeonConPereza Bienvenido/a! HeaLth_Rider [Fan] de .::RadioLuna::. [01:54] LeonConPereza
Bienvenido/a! HeaLth_Rider [Fan] de .::RadioLuna::.
[01:55] Libelula\SinRespeto 2 Pista: x-w****** 30 segundos y 25000 Puntos [01:55] Libelula\SinRespeto
2 Pista: x-w****** 30 segundos y 25000 Puntos
[01:55] Libelula\SinRespeto 3 Pista: x-wi**o** 15 segundos y 25000 Puntos [01:55] Libelula\SinRespeto
3 Pista: x-wi**o** 15 segundos y 25000 Puntos
[01:55] Libelula\SinRespeto Tiempo! La respuesta es -> x-windows <- [01:55] Libelula\SinRespeto
Tiempo! La respuesta es -> x-windows <-
[01:55] Libelula\SinRespeto R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 17799075 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 13963595 #5: Culebra}Agil 10731654 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3677435 [01:55] Libelula\SinRespeto
R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 17799075 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 13963595 #5: Culebra}Agil 10731654 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3677435
[01:55] Libelula\SinRespeto Tri.14894 Personajesɬeper˿(dibujos)ߣ󭯃01userllamawelwperrouderheidi?f?f [01:55] Libelula\SinRespeto
Tri.14894 Personajesɬeper˿(dibujos)ߣ󭯃01userllamawelwperrouderheidi?f?f
[01:55] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 15830 Puntos [01:55] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 15830 Puntos
[01:56] Libelula\SinRespeto 2 Pista: nie*** 30 segundos y 15830 Puntos [01:56] Libelula\SinRespeto
2 Pista: nie*** 30 segundos y 15830 Puntos
[01:56] Libelula\SinRespeto �Est᳠que lo tiras Aguila}Insufrible!! ߃󭯠supiste que "niebla" era la respuesta? Venga, �5830�12 puntos suben a tu marcador [01:56] Libelula\SinRespeto
�Est᳠que lo tiras Aguila}Insufrible!! ߃󭯠supiste que "niebla" era la respuesta? Venga, �5830�12 puntos suben a tu marcador
[01:56] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [01:56] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[01:56] Libelula\SinRespeto Aguila}Insufrible has acertado 2 seguidas!! Puntos HOY: 25906, SEMANA: 17814905 y MES: 14143342 [01:56] Libelula\SinRespeto
Aguila}Insufrible has acertado 2 seguidas!! Puntos HOY: 25906, SEMANA: 17814905 y MES: 14143342
[01:56] Aguila}Insufrible niebla [01:56] Aguila}Insufrible
niebla
[01:56] Libelula\SinRespeto We feature over 50,000 Q&A ! [01:56] Libelula\SinRespeto
We feature over 50,000 Q&A !
[01:56] Libelula\SinRespeto Tri.14052 Eros-Sexɇoo˿Comowsenllamacaclasmperdidasmdensangrenentrenciclosmmenstrualesm?t [01:56] Libelula\SinRespeto
Tri.14052 Eros-Sexɇoo˿Comowsenllamacaclasmperdidasmdensangrenentrenciclosmmenstrualesm?t
[01:56] Libelula\SinRespeto 1 Pista: ************ Valor pregunta : 9448 Puntos [01:56] Libelula\SinRespeto
1 Pista: ************ Valor pregunta : 9448 Puntos
[01:56] Libelula\SinRespeto 2 Pista: met********* 30 segundos y 9448 Puntos [01:56] Libelula\SinRespeto
2 Pista: met********* 30 segundos y 9448 Puntos
[01:57] Libelula\SinRespeto 3 Pista: met*o**a*ia* 15 segundos y 9448 Puntos [01:57] Libelula\SinRespeto
3 Pista: met*o**a*ia* 15 segundos y 9448 Puntos
[01:57] Libelula\SinRespeto Tiempo! La respuesta es -> metrorragias <- [01:57] Libelula\SinRespeto
Tiempo! La respuesta es -> metrorragias <-
[01:57] Libelula\SinRespeto Tri.437 InformaticaɎAPINE˿ENsQUEsA񏃰1sSEsCREOsLAsASOCIACIONsESPA񏌁sDEsUSUARIOSsDEsINTERNETs(AUI)s?s [01:57] Libelula\SinRespeto
Tri.437 InformaticaɎAPINE˿ENsQUEsA񏃰1sSEsCREOsLAsASOCIACIONsESPA񏌁sDEsUSUARIOSsDEsINTERNETs(AUI)s?s
[01:57] Libelula\SinRespeto 1 Pista: **** Valor pregunta : 16707 Puntos [01:57] Libelula\SinRespeto
1 Pista: **** Valor pregunta : 16707 Puntos
[01:57] Libelula\SinRespeto 2 Pista: 199* 30 segundos y 16707 Puntos [01:57] Libelula\SinRespeto
2 Pista: 199* 30 segundos y 16707 Puntos
[01:57] Libelula\SinRespeto 3 Pista: 199* 15 segundos y 16707 Puntos [01:57] Libelula\SinRespeto
3 Pista: 199* 15 segundos y 16707 Puntos
[01:58] Libelula\SinRespeto Tiempo! La respuesta es -> 1995 <- [01:58] Libelula\SinRespeto
Tiempo! La respuesta es -> 1995 <-
[01:58] Libelula\SinRespeto Tri.18007 LiteraturaɍARdeJAVAˑUɃ01rAUTORAr(1515-1582)rESCRIBIӃ01r"rLIBROrDErMIrVIDA".r?r [01:58] Libelula\SinRespeto
Tri.18007 LiteraturaɍARdeJAVAˑUɃ01rAUTORAr(1515-1582)rESCRIBIӃ01r"rLIBROrDErMIrVIDA".r?r
[01:58] Libelula\SinRespeto 1 Pista: ***** ****** ** ***** Valor pregunta : 12892 Puntos [01:58] Libelula\SinRespeto
1 Pista: ***** ****** ** ***** Valor pregunta : 12892 Puntos
[01:58] Libelula\SinRespeto 2 Pista: san** ****** ** ***** 30 segundos y 12892 Puntos [01:58] Libelula\SinRespeto
2 Pista: san** ****** ** ***** 30 segundos y 12892 Puntos
[01:58] Libelula\SinRespeto 3 Pista: san*a *e*e*a *e *e*u* 15 segundos y 12892 Puntos [01:58] Libelula\SinRespeto
3 Pista: san*a *e*e*a *e *e*u* 15 segundos y 12892 Puntos
[01:59] Libelula\SinRespeto Tiempo! La respuesta es -> santa�eresa�e�esus <- [01:59] Libelula\SinRespeto
Tiempo! La respuesta es -> santa�eresa�e�esus <-
[01:59] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [01:59] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[01:59] Libelula\SinRespeto Tri.5374 Medicina-Saludɚytox˿Cualxesilaxunidadmdegmedidaxdeglaxtensionjarterialx(noeesielxmm)q?q [01:59] Libelula\SinRespeto
Tri.5374 Medicina-Saludɚytox˿Cualxesilaxunidadmdegmedidaxdeglaxtensionjarterialx(noeesielxmm)q?q
[01:59] Libelula\SinRespeto 1 Pista: ********** ** ******** Valor pregunta : 23127 Puntos [01:59] Libelula\SinRespeto
1 Pista: ********** ** ******** Valor pregunta : 23127 Puntos
[01:59] Libelula\SinRespeto 2 Pista: cen******* ** ******** 30 segundos y 23127 Puntos [01:59] Libelula\SinRespeto
2 Pista: cen******* ** ******** 30 segundos y 23127 Puntos
[01:59] Libelula\SinRespeto 3 Pista: cen*i*e**o *e *e**u*io 15 segundos y 23127 Puntos [01:59] Libelula\SinRespeto
3 Pista: cen*i*e**o *e *e**u*io 15 segundos y 23127 Puntos
[02:00] Libelula\SinRespeto Tiempo! La respuesta es -> centimetro�e�ercurio <- [02:00] Libelula\SinRespeto
Tiempo! La respuesta es -> centimetro�e�ercurio <-
[02:00] Libelula\SinRespeto R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0 [02:00] Libelula\SinRespeto
R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0
[02:00] Libelula\SinRespeto Tri.10306 MiscelaneaɔeLaRaNhA˿Albmalbtorerow?p [02:00] Libelula\SinRespeto
Tri.10306 MiscelaneaɔeLaRaNhA˿Albmalbtorerow?p
[02:00] Libelula\SinRespeto 1 Pista: ***** *** ******* ** ******** Valor pregunta : 21941 Puntos [02:00] Libelula\SinRespeto
1 Pista: ***** *** ******* ** ******** Valor pregunta : 21941 Puntos
[02:00] Libelula\SinRespeto 2 Pista: has** *** ******* ** ******** 30 segundos y 21941 Puntos [02:00] Libelula\SinRespeto
2 Pista: has** *** ******* ** ******** 30 segundos y 21941 Puntos
[02:00] Libelula\SinRespeto 3 Pista: has*a *o* *ue**o* *e *o*e**a* 15 segundos y 21941 Puntos [02:00] Libelula\SinRespeto
3 Pista: has*a *o* *ue**o* *e *o*e**a* 15 segundos y 21941 Puntos
[02:01] Libelula\SinRespeto Tiempo! La respuesta es -> hasta�os�uernos�e�olestan <- [02:01] Libelula\SinRespeto
Tiempo! La respuesta es -> hasta�os�uernos�e�olestan <-
[02:01] Libelula\SinRespeto If you think a Q&A is wrong, please call an OP [02:01] Libelula\SinRespeto
If you think a Q&A is wrong, please call an OP
[02:01] Libelula\SinRespeto Tri.12991 Cancionesɓort˿DebquienwesvlaxcancionwSINvTECHOv?v [02:01] Libelula\SinRespeto
Tri.12991 Cancionesɓort˿DebquienwesvlaxcancionwSINvTECHOv?v
[02:01] Libelula\SinRespeto 1 Pista: *** ****** Valor pregunta : 8505 Puntos [02:01] Libelula\SinRespeto
1 Pista: *** ****** Valor pregunta : 8505 Puntos
[02:01] Libelula\SinRespeto 2 Pista: los ****** 30 segundos y 8505 Puntos [02:01] Libelula\SinRespeto
2 Pista: los ****** 30 segundos y 8505 Puntos
[02:01] Libelula\SinRespeto 3 Pista: los *ua*e* 15 segundos y 8505 Puntos [02:01] Libelula\SinRespeto
3 Pista: los *ua*e* 15 segundos y 8505 Puntos
[02:02] Libelula\SinRespeto Tiempo! La respuesta es -> los�uaves <- [02:02] Libelula\SinRespeto
Tiempo! La respuesta es -> los�uaves <-
[02:02] Libelula\SinRespeto R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0 [02:02] Libelula\SinRespeto
R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0
[02:02] Libelula\SinRespeto Tri.3896 GeografiaɍARdeJAVA˿ENxQUɃ01xESTADOxALEM�xSExENCUENTRAxLAxCIUDADxDExWܒZBURG?x?x [02:02] Libelula\SinRespeto
Tri.3896 GeografiaɍARdeJAVA˿ENxQUɃ01xESTADOxALEM�xSExENCUENTRAxLAxCIUDADxDExWܒZBURG?x?x
[02:02] Libelula\SinRespeto 1 Pista: ******* Valor pregunta : 22393 Puntos [02:02] Libelula\SinRespeto
1 Pista: ******* Valor pregunta : 22393 Puntos
[02:02] Libelula\SinRespeto 2 Pista: bav**** 30 segundos y 22393 Puntos [02:02] Libelula\SinRespeto
2 Pista: bav**** 30 segundos y 22393 Puntos
[02:02] Libelula\SinRespeto 3 Pista: bavie*a 15 segundos y 22393 Puntos [02:02] Libelula\SinRespeto
3 Pista: bavie*a 15 segundos y 22393 Puntos
[02:03] Libelula\SinRespeto Tiempo! La respuesta es -> baviera <- [02:03] Libelula\SinRespeto
Tiempo! La respuesta es -> baviera <-
[02:03] Libelula\SinRespeto For The Competitive Edge type !pingme [02:03] Libelula\SinRespeto
For The Competitive Edge type !pingme
[02:03] Libelula\SinRespeto Tri.17193 Biologiaɔurkesa˿Cualsestelscentrovdeuinvestigacionqdesdeuelsqueuseuorganizaronqlastgrandestexpedicionestcientificast(botanicas)saxAmericaxenqelssiglovXVIIIsenqEspa񡃰1x?s [02:03] Libelula\SinRespeto
Tri.17193 Biologiaɔurkesa˿Cualsestelscentrovdeuinvestigacionqdesdeuelsqueuseuorganizaronqlastgrandestexpedicionestcientificast(botanicas)saxAmericaxenqelssiglovXVIIIsenqEspa񡃰1x?s
[02:03] Libelula\SinRespeto 1 Pista: **** ****** ******** Valor pregunta : 22233 Puntos [02:03] Libelula\SinRespeto
1 Pista: **** ****** ******** Valor pregunta : 22233 Puntos
[02:03] Libelula\SinRespeto 2 Pista: rea* ****** ******** 30 segundos y 22233 Puntos [02:03] Libelula\SinRespeto
2 Pista: rea* ****** ******** 30 segundos y 22233 Puntos
[02:03] Libelula\SinRespeto 3 Pista: rea* *a**i* *o*a*i*o 15 segundos y 22233 Puntos [02:03] Libelula\SinRespeto
3 Pista: rea* *a**i* *o*a*i*o 15 segundos y 22233 Puntos
[02:03] Libelula\SinRespeto Tiempo! La respuesta es -> real�ardin�otanico <- [02:03] Libelula\SinRespeto
Tiempo! La respuesta es -> real�ardin�otanico <-
[02:04] Libelula\SinRespeto Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [02:04] Libelula\SinRespeto
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[02:04] Libelula\SinRespeto Tri.2276 Deporteɨupper˿COMOqSEqLLAMABAqELqARBRITOqQIEqPITOqELqESPA񁃰1q-qCOREAqDELqSURqDELqMUNDIALqDEqCOREAqYqJAPON?q?q [02:04] Libelula\SinRespeto
Tri.2276 Deporteɨupper˿COMOqSEqLLAMABAqELqARBRITOqQIEqPITOqELqESPA񁃰1q-qCOREAqDELqSURqDELqMUNDIALqDEqCOREAqYqJAPON?q?q
[02:04] Libelula\SinRespeto 1 Pista: ** ******* Valor pregunta : 9892 Puntos [02:04] Libelula\SinRespeto
1 Pista: ** ******* Valor pregunta : 9892 Puntos
[02:04] Libelula\SinRespeto 2 Pista: al�****** 30 segundos y 9892 Puntos [02:04] Libelula\SinRespeto
2 Pista: al�****** 30 segundos y 9892 Puntos
[02:04] Libelula\SinRespeto 3 Pista: al�a**ou* 15 segundos y 9892 Puntos [02:04] Libelula\SinRespeto
3 Pista: al�a**ou* 15 segundos y 9892 Puntos
[02:04] Libelula\SinRespeto Tiempo! La respuesta es -> al�andour <- [02:04] Libelula\SinRespeto
Tiempo! La respuesta es -> al�andour <-
[02:05] Libelula\SinRespeto R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 14143342 #4: Cocodrilo-ConPrisa 13963595 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3677435 #9: LaCamelia 3029384 #10: Karen 1224969 [02:05] Libelula\SinRespeto
R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 14143342 #4: Cocodrilo-ConPrisa 13963595 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3677435 #9: LaCamelia 3029384 #10: Karen 1224969
[02:05] Libelula\SinRespeto Tri.17657 Miscelaneaɓebosin˿Ayudabaaaalosmpiratasmantillanosmaapescarcsusmmerluzas?i?i [02:05] Libelula\SinRespeto
Tri.17657 Miscelaneaɓebosin˿Ayudabaaaalosmpiratasmantillanosmaapescarcsusmmerluzas?i?i
[02:05] Libelula\SinRespeto 1 Pista: *** Valor pregunta : 14164 Puntos [02:05] Libelula\SinRespeto
1 Pista: *** Valor pregunta : 14164 Puntos
[02:05] Libelula\SinRespeto 2 Pista: ron 30 segundos y 14164 Puntos [02:05] Libelula\SinRespeto
2 Pista: ron 30 segundos y 14164 Puntos
[02:05] Libelula\SinRespeto 3 Pista: ron 15 segundos y 14164 Puntos [02:05] Libelula\SinRespeto
3 Pista: ron 15 segundos y 14164 Puntos
[02:05] Libelula\SinRespeto Tiempo! La respuesta es -> ron <- [02:05] Libelula\SinRespeto
Tiempo! La respuesta es -> ron <-
[02:06] Libelula\SinRespeto Please refrain from using Extreme Bad Language [02:06] Libelula\SinRespeto
Please refrain from using Extreme Bad Language
[02:06] Libelula\SinRespeto Tri.6994 Personajesɴjmm.comˏbispopanglicanopsudafricano,tpremiopNobelmdeklahPazt1984tporususluchahcontrahelmapartheid.t?t [02:06] Libelula\SinRespeto
Tri.6994 Personajesɴjmm.comˏbispopanglicanopsudafricano,tpremiopNobelmdeklahPazt1984tporususluchahcontrahelmapartheid.t?t
[02:06] Libelula\SinRespeto 1 Pista: ******* **** Valor pregunta : 20438 Puntos [02:06] Libelula\SinRespeto
1 Pista: ******* **** Valor pregunta : 20438 Puntos
[02:06] LeonConPereza Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas [02:06] LeonConPereza
Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas
[02:06] Libelula\SinRespeto 2 Pista: des**** **** 30 segundos y 20438 Puntos [02:06] Libelula\SinRespeto
2 Pista: des**** **** 30 segundos y 20438 Puntos
[02:06] Libelula\SinRespeto 3 Pista: des*o** *u*u 15 segundos y 20438 Puntos [02:06] Libelula\SinRespeto
3 Pista: des*o** *u*u 15 segundos y 20438 Puntos
[02:06] Libelula\SinRespeto Tiempo! La respuesta es -> desmond�utu <- [02:06] Libelula\SinRespeto
Tiempo! La respuesta es -> desmond�utu <-
[02:07] Libelula\SinRespeto This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto [02:07] Libelula\SinRespeto
This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto
[02:07] Libelula\SinRespeto Tri.15817 MitologiaɍARdeJAVA˿CӍOaSEaLLAMAaELaMONSTRUOaASUSTACHICOSaM�aPOPULARaENaCATALUс,aQUEaDEVORAaAaLOSaNIяSaSINaMASTICARLOS?a?a [02:07] Libelula\SinRespeto
Tri.15817 MitologiaɍARdeJAVA˿CӍOaSEaLLAMAaELaMONSTRUOaASUSTACHICOSaM�aPOPULARaENaCATALUс,aQUEaDEVORAaAaLOSaNIяSaSINaMASTICARLOS?a?a
[02:07] Libelula\SinRespeto 1 Pista: **** Valor pregunta : 15908 Puntos [02:07] Libelula\SinRespeto
1 Pista: **** Valor pregunta : 15908 Puntos
[02:07] Libelula\SinRespeto 2 Pista: pap* 30 segundos y 15908 Puntos [02:07] Libelula\SinRespeto
2 Pista: pap* 30 segundos y 15908 Puntos
[02:07] Libelula\SinRespeto 3 Pista: papu 15 segundos y 15908 Puntos [02:07] Libelula\SinRespeto
3 Pista: papu 15 segundos y 15908 Puntos
[02:07] Libelula\SinRespeto Tiempo! La respuesta es -> papu <- [02:07] Libelula\SinRespeto
Tiempo! La respuesta es -> papu <-
[02:07] Libelula\SinRespeto This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 552740 #19: karen-62 535210 #20: Carlos_55 468075 [02:07] Libelula\SinRespeto
This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 552740 #19: karen-62 535210 #20: Carlos_55 468075
[02:07] Libelula\SinRespeto Tri.18103 CineɉRC-Domain.org˿ComonseeescribeeelfapellidondeeArnold...h?h [02:07] Libelula\SinRespeto
Tri.18103 CineɉRC-Domain.org˿ComonseeescribeeelfapellidondeeArnold...h?h
[02:07] Libelula\SinRespeto 1 Pista: ************** Valor pregunta : 18004 Puntos [02:07] Libelula\SinRespeto
1 Pista: ************** Valor pregunta : 18004 Puntos
[02:08] Libelula\SinRespeto 2 Pista: sch*********** 30 segundos y 18004 Puntos [02:08] Libelula\SinRespeto
2 Pista: sch*********** 30 segundos y 18004 Puntos
[02:08] Libelula\SinRespeto 3 Pista: sch*a**e*e**e* 15 segundos y 18004 Puntos [02:08] Libelula\SinRespeto
3 Pista: sch*a**e*e**e* 15 segundos y 18004 Puntos
[02:08] Libelula\SinRespeto Tiempo! La respuesta es -> schwarzenegger <- [02:08] Libelula\SinRespeto
Tiempo! La respuesta es -> schwarzenegger <-
[02:08] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [02:08] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[02:08] Libelula\SinRespeto Tri.1555 Idiomasɴjmm.com˿Delcfranc鳃01ualcespa񯬺aQuatre-vingtq?a [02:08] Libelula\SinRespeto
Tri.1555 Idiomasɴjmm.com˿Delcfranc鳃01ualcespa񯬺aQuatre-vingtq?a
[02:08] Libelula\SinRespeto 1 Pista: ******* Valor pregunta : 18826 Puntos [02:08] Libelula\SinRespeto
1 Pista: ******* Valor pregunta : 18826 Puntos
[02:09] Libelula\SinRespeto 2 Pista: Och**** 30 segundos y 18826 Puntos [02:09] Libelula\SinRespeto
2 Pista: Och**** 30 segundos y 18826 Puntos
[02:09] Libelula\SinRespeto 3 Pista: Oche**a 15 segundos y 18826 Puntos [02:09] Libelula\SinRespeto
3 Pista: Oche**a 15 segundos y 18826 Puntos
[02:09] Libelula\SinRespeto Tiempo! La respuesta es -> Ochenta <- [02:09] Libelula\SinRespeto
Tiempo! La respuesta es -> Ochenta <-
[02:09] Libelula\SinRespeto This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 572184 #15: Aguila-Especial 543035 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704 [02:09] Libelula\SinRespeto
This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 572184 #15: Aguila-Especial 543035 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704
[02:09] Libelula\SinRespeto Tri.8673 Arteɂuzzati˿ANTIGUOaMONUMENTOaCONMEMORATIVOaENaFORMAaDEaL�IDA,aQUEaSEaDECORABAaCONaRELIEVESaALUSIVOSaAaLAaVIDAaDELaDIFUNTOa?a [02:09] Libelula\SinRespeto
Tri.8673 Arteɂuzzati˿ANTIGUOaMONUMENTOaCONMEMORATIVOaENaFORMAaDEaL�IDA,aQUEaSEaDECORABAaCONaRELIEVESaALUSIVOSaAaLAaVIDAaDELaDIFUNTOa?a
[02:09] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 17635 Puntos [02:09] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 17635 Puntos
[02:10] Libelula\SinRespeto 2 Pista: est*** 30 segundos y 17635 Puntos [02:10] Libelula\SinRespeto
2 Pista: est*** 30 segundos y 17635 Puntos
[02:10] Aguila}Insufrible estela [02:10] Aguila}Insufrible
estela
[02:10] Libelula\SinRespeto �Absolutamente correcto Aguila}Insufrible!! Acertaste "estela" en �8.14 segundos y ganas �7635�12 puntos [02:10] Libelula\SinRespeto
�Absolutamente correcto Aguila}Insufrible!! Acertaste "estela" en �8.14 segundos y ganas �7635�12 puntos
[02:10] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:10] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:10] Libelula\SinRespeto Aguila}Insufrible has acertado 3 seguidas!! Puntos HOY: 43541, SEMANA: 17832540 y MES: 14160977 [02:10] Libelula\SinRespeto
Aguila}Insufrible has acertado 3 seguidas!! Puntos HOY: 43541, SEMANA: 17832540 y MES: 14160977
[02:10] Libelula\SinRespeto R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0 [02:10] Libelula\SinRespeto
R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0
[02:10] Libelula\SinRespeto Tri.16756 Cancionesɂuzzati˿Dehquehgrupohesu"BrassuInrPocket"i?i [02:10] Libelula\SinRespeto
Tri.16756 Cancionesɂuzzati˿Dehquehgrupohesu"BrassuInrPocket"i?i
[02:10] Libelula\SinRespeto 1 Pista: ********** Valor pregunta : 24581 Puntos [02:10] Libelula\SinRespeto
1 Pista: ********** Valor pregunta : 24581 Puntos
[02:10] Libelula\SinRespeto 2 Pista: pre******* 30 segundos y 24581 Puntos [02:10] Libelula\SinRespeto
2 Pista: pre******* 30 segundos y 24581 Puntos
[02:10] Libelula\SinRespeto 3 Pista: pre*e**e** 15 segundos y 24581 Puntos [02:10] Libelula\SinRespeto
3 Pista: pre*e**e** 15 segundos y 24581 Puntos
[02:11] Libelula\SinRespeto Tiempo! La respuesta es -> pretenders <- [02:11] Libelula\SinRespeto
Tiempo! La respuesta es -> pretenders <-
[02:11] Libelula\SinRespeto Top10 Players ( Weekly & Monthly ) are Auto-Voiced [02:11] Libelula\SinRespeto
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[02:11] Libelula\SinRespeto Tri.15543 Cotilleo-TVɒachy˿C󭯃01isexllamaqely"ex"adexCarmenzMorales"a?a [02:11] Libelula\SinRespeto
Tri.15543 Cotilleo-TVɒachy˿C󭯃01isexllamaqely"ex"adexCarmenzMorales"a?a
[02:11] Libelula\SinRespeto 1 Pista: ***** ****** Valor pregunta : 24985 Puntos [02:11] Libelula\SinRespeto
1 Pista: ***** ****** Valor pregunta : 24985 Puntos
[02:11] Libelula\SinRespeto 2 Pista: osc** ****** 30 segundos y 24985 Puntos [02:11] Libelula\SinRespeto
2 Pista: osc** ****** 30 segundos y 24985 Puntos
[02:11] Libelula\SinRespeto 3 Pista: osca* *o*a*o 15 segundos y 24985 Puntos [02:11] Libelula\SinRespeto
3 Pista: osca* *o*a*o 15 segundos y 24985 Puntos
[02:12] Libelula\SinRespeto Tiempo! La respuesta es -> oscar�ozano <- [02:12] Libelula\SinRespeto
Tiempo! La respuesta es -> oscar�ozano <-
[02:12] Libelula\SinRespeto Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [02:12] Libelula\SinRespeto
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[02:12] Libelula\SinRespeto Tri.8832 Historiaɉcia˿CualpfuegelpmotivovquegdiovEE.UU.tparauintervenirwenc1898tencelpconflictovhispano-cubanov?t [02:12] Libelula\SinRespeto
Tri.8832 Historiaɉcia˿CualpfuegelpmotivovquegdiovEE.UU.tparauintervenirwenc1898tencelpconflictovhispano-cubanov?t
[02:12] Libelula\SinRespeto 1 Pista: ********* *** ********* ***** Valor pregunta : 8441 Puntos [02:12] Libelula\SinRespeto
1 Pista: ********* *** ********* ***** Valor pregunta : 8441 Puntos
[02:12] Libelula\SinRespeto 2 Pista: exp****** *** ********* ***** 30 segundos y 8441 Puntos [02:12] Libelula\SinRespeto
2 Pista: exp****** *** ********* ***** 30 segundos y 8441 Puntos
[02:12] Libelula\SinRespeto 3 Pista: exp*o*io* *e* a*o*a*a*o *ai*e 15 segundos y 8441 Puntos [02:12] Libelula\SinRespeto
3 Pista: exp*o*io* *e* a*o*a*a*o *ai*e 15 segundos y 8441 Puntos
[02:13] Libelula\SinRespeto Tiempo! La respuesta es -> explosion�el�corazado�aine <- [02:13] Libelula\SinRespeto
Tiempo! La respuesta es -> explosion�el�corazado�aine <-
[02:13] Libelula\SinRespeto R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 17832540 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 13963595 #5: Culebra}Agil 10731654 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3677435 [02:13] Libelula\SinRespeto
R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 17832540 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 13963595 #5: Culebra}Agil 10731654 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3677435
[02:13] Libelula\SinRespeto Tri.1305 Informaticaɐax˿AdquermodoipasaruneprocesadorzIA-64dpararprocesarzlastinterrupcionest?d [02:13] Libelula\SinRespeto
Tri.1305 Informaticaɐax˿AdquermodoipasaruneprocesadorzIA-64dpararprocesarzlastinterrupcionest?d
[02:13] Libelula\SinRespeto 1 Pista: **-** Valor pregunta : 22447 Puntos [02:13] Libelula\SinRespeto
1 Pista: **-** Valor pregunta : 22447 Puntos
[02:13] Libelula\SinRespeto 2 Pista: IA-** 30 segundos y 22447 Puntos [02:13] Libelula\SinRespeto
2 Pista: IA-** 30 segundos y 22447 Puntos
[02:13] Libelula\SinRespeto 3 Pista: IA-** 15 segundos y 22447 Puntos [02:13] Libelula\SinRespeto
3 Pista: IA-** 15 segundos y 22447 Puntos
[02:14] Libelula\SinRespeto Tiempo! La respuesta es -> IA-64 <- [02:14] Libelula\SinRespeto
Tiempo! La respuesta es -> IA-64 <-
[02:14] Libelula\SinRespeto We feature over 50,000 Q&A ! [02:14] Libelula\SinRespeto
We feature over 50,000 Q&A !
[02:14] Libelula\SinRespeto Tri.13469 Cienciaɳtephenwo˿Comoqsebdenominauaulauproyecci󮃰1lparcialboqtotalbdelbgloboqenlunlplano?y?y [02:14] Libelula\SinRespeto
Tri.13469 Cienciaɳtephenwo˿Comoqsebdenominauaulauproyecci󮃰1lparcialboqtotalbdelbgloboqenlunlplano?y?y
[02:14] Libelula\SinRespeto 1 Pista: **** Valor pregunta : 17618 Puntos [02:14] Libelula\SinRespeto
1 Pista: **** Valor pregunta : 17618 Puntos
[02:14] Libelula\SinRespeto 2 Pista: map* 30 segundos y 17618 Puntos [02:14] Libelula\SinRespeto
2 Pista: map* 30 segundos y 17618 Puntos
[02:14] Libelula\SinRespeto 3 Pista: mapa 15 segundos y 17618 Puntos [02:14] Libelula\SinRespeto
3 Pista: mapa 15 segundos y 17618 Puntos
[02:14] Aguila}Insufrible mapa [02:14] Aguila}Insufrible
mapa
[02:14] Libelula\SinRespeto �Muy bien Aguila}Insufrible!! Acertaste "mapa" en tan s󬯠�0.656 segundos y por eso has ganado: �7618�12 puntos [02:14] Libelula\SinRespeto
�Muy bien Aguila}Insufrible!! Acertaste "mapa" en tan s󬯠�0.656 segundos y por eso has ganado: �7618�12 puntos
[02:14] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:14] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:14] Libelula\SinRespeto Aguila}Insufrible has acertado 4 seguidas!! Puntos HOY: 61159, SEMANA: 17850158 y MES: 14178595 [02:14] Libelula\SinRespeto
Aguila}Insufrible has acertado 4 seguidas!! Puntos HOY: 61159, SEMANA: 17850158 y MES: 14178595
[02:15] Libelula\SinRespeto Tri.3799 Arteɓibila˿DONDElESTAlLAlFUNDACIONlMIROl?l [02:15] Libelula\SinRespeto
Tri.3799 Arteɓibila˿DONDElESTAlLAlFUNDACIONlMIROl?l
[02:15] Libelula\SinRespeto 1 Pista: ********* Valor pregunta : 17036 Puntos [02:15] Libelula\SinRespeto
1 Pista: ********* Valor pregunta : 17036 Puntos
[02:15] Libelula\SinRespeto 2 Pista: bar****** 30 segundos y 17036 Puntos [02:15] Libelula\SinRespeto
2 Pista: bar****** 30 segundos y 17036 Puntos
[02:15] Libelula\SinRespeto 3 Pista: bar*e*o*a 15 segundos y 17036 Puntos [02:15] Libelula\SinRespeto
3 Pista: bar*e*o*a 15 segundos y 17036 Puntos
[02:15] Libelula\SinRespeto Tiempo! La respuesta es -> barcelona <- [02:15] Libelula\SinRespeto
Tiempo! La respuesta es -> barcelona <-
[02:16] Libelula\SinRespeto Tri.7498 PoliticaɍARdeJAVA˅NmELmNڍEROm10mDEmQUɃ01mCALLEmVIVEmELmPRIMERmMINISTROmBRIT�ICOmTONYmBLAIR?m?m [02:16] Libelula\SinRespeto
Tri.7498 PoliticaɍARdeJAVA˅NmELmNڍEROm10mDEmQUɃ01mCALLEmVIVEmELmPRIMERmMINISTROmBRIT�ICOmTONYmBLAIR?m?m
[02:16] Libelula\SinRespeto 1 Pista: ******* ****** Valor pregunta : 5912 Puntos [02:16] Libelula\SinRespeto
1 Pista: ******* ****** Valor pregunta : 5912 Puntos
[02:16] Libelula\SinRespeto 2 Pista: dow**** ****** 30 segundos y 5912 Puntos [02:16] Libelula\SinRespeto
2 Pista: dow**** ****** 30 segundos y 5912 Puntos
[02:16] Libelula\SinRespeto 3 Pista: dow*i** ***ee* 15 segundos y 5912 Puntos [02:16] Libelula\SinRespeto
3 Pista: dow*i** ***ee* 15 segundos y 5912 Puntos
[02:16] Libelula\SinRespeto Tiempo! La respuesta es -> downing�treet <- [02:16] Libelula\SinRespeto
Tiempo! La respuesta es -> downing�treet <-
[02:17] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [02:17] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[02:17] Libelula\SinRespeto Tri.4848 LiteraturaɁntiquo˿CUALpHApSIDOpELpPOETApMaSpREPRESENTATIVOpDEpLApLIRICApPORTUGUESAp?p [02:17] Libelula\SinRespeto
Tri.4848 LiteraturaɁntiquo˿CUALpHApSIDOpELpPOETApMaSpREPRESENTATIVOpDEpLApLIRICApPORTUGUESAp?p
[02:17] Libelula\SinRespeto 1 Pista: ******* Valor pregunta : 14508 Puntos [02:17] Libelula\SinRespeto
1 Pista: ******* Valor pregunta : 14508 Puntos
[02:17] Libelula\SinRespeto 2 Pista: cam**** 30 segundos y 14508 Puntos [02:17] Libelula\SinRespeto
2 Pista: cam**** 30 segundos y 14508 Puntos
[02:17] Libelula\SinRespeto 3 Pista: camoe** 15 segundos y 14508 Puntos [02:17] Libelula\SinRespeto
3 Pista: camoe** 15 segundos y 14508 Puntos
[02:17] Libelula\SinRespeto Tiempo! La respuesta es -> camoens <- [02:17] Libelula\SinRespeto
Tiempo! La respuesta es -> camoens <-
[02:18] Libelula\SinRespeto R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0 [02:18] Libelula\SinRespeto
R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0
[02:18] Libelula\SinRespeto Tri.12262 Geografiaɓebosin˿Engqu郰1sislavsenencuentravlavCalderavdenTaburiente?s?s [02:18] Libelula\SinRespeto
Tri.12262 Geografiaɓebosin˿Engqu郰1sislavsenencuentravlavCalderavdenTaburiente?s?s
[02:18] Libelula\SinRespeto 1 Pista: ** ***** Pregunta de BONUS : 25000 Puntos [02:18] Libelula\SinRespeto
1 Pista: ** ***** Pregunta de BONUS : 25000 Puntos
[02:18] Libelula\SinRespeto 2 Pista: la�**** 30 segundos y 25000 Puntos [02:18] Libelula\SinRespeto
2 Pista: la�**** 30 segundos y 25000 Puntos
[02:18] Libelula\SinRespeto 3 Pista: la�a**a 15 segundos y 25000 Puntos [02:18] Libelula\SinRespeto
3 Pista: la�a**a 15 segundos y 25000 Puntos
[02:18] Libelula\SinRespeto Tiempo! La respuesta es -> la�alma <- [02:18] Libelula\SinRespeto
Tiempo! La respuesta es -> la�alma <-
[02:18] Libelula\SinRespeto If you think a Q&A is wrong, please call an OP [02:18] Libelula\SinRespeto
If you think a Q&A is wrong, please call an OP
[02:18] Libelula\SinRespeto Tri.20521 Cotilleo-TVɚytox˿CualmeraeelmprogramaedecEmiliovAragonxenxT5j?j [02:18] Libelula\SinRespeto
Tri.20521 Cotilleo-TVɚytox˿CualmeraeelmprogramaedecEmiliovAragonxenxT5j?j
[02:18] Libelula\SinRespeto 1 Pista: *** Valor pregunta : 6843 Puntos [02:18] Libelula\SinRespeto
1 Pista: *** Valor pregunta : 6843 Puntos
[02:19] Libelula\SinRespeto 2 Pista: vip 30 segundos y 6843 Puntos [02:19] Libelula\SinRespeto
2 Pista: vip 30 segundos y 6843 Puntos
[02:19] Aguila}Insufrible vip [02:19] Aguila}Insufrible
vip
[02:19] Libelula\SinRespeto �Est᳠que lo tiras Aguila}Insufrible!! ߃󭯠supiste que "vip" era la respuesta? Venga, �843�12 puntos suben a tu marcador [02:19] Libelula\SinRespeto
�Est᳠que lo tiras Aguila}Insufrible!! ߃󭯠supiste que "vip" era la respuesta? Venga, �843�12 puntos suben a tu marcador
[02:19] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:19] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:19] Libelula\SinRespeto Aguila}Insufrible has acertado 5 seguidas!! Puntos HOY: 68002, SEMANA: 17857001 y MES: 14185438 [02:19] Libelula\SinRespeto
Aguila}Insufrible has acertado 5 seguidas!! Puntos HOY: 68002, SEMANA: 17857001 y MES: 14185438
[02:19] Libelula\SinRespeto R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0 [02:19] Libelula\SinRespeto
R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0
[02:19] Libelula\SinRespeto Tri.14571 Gastronomiaɬatigoo˿Deed󮤥esonnt�casflasf񯲡sf?w [02:19] Libelula\SinRespeto
Tri.14571 Gastronomiaɬatigoo˿Deed󮤥esonnt�casflasf񯲡sf?w
[02:19] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 20306 Puntos [02:19] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 20306 Puntos
[02:19] Aguila}Insufrible chile [02:19] Aguila}Insufrible
chile
[02:19] Aguila}Insufrible mexico [02:19] Aguila}Insufrible
mexico
[02:19] Libelula\SinRespeto 2 Pista: mur*** 30 segundos y 20306 Puntos [02:19] Libelula\SinRespeto
2 Pista: mur*** 30 segundos y 20306 Puntos
[02:19] Aguila}Insufrible murcia [02:19] Aguila}Insufrible
murcia
[02:19] Libelula\SinRespeto �As�e hace Aguila}Insufrible!! Contestaste "murcia" en �7.046 segundos y sumas �0306�12 puntos [02:19] Libelula\SinRespeto
�As�e hace Aguila}Insufrible!! Contestaste "murcia" en �7.046 segundos y sumas �0306�12 puntos
[02:19] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:19] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:19] Libelula\SinRespeto Aguila}Insufrible has acertado 6 seguidas!! Puntos HOY: 88308, SEMANA: 17877307 y MES: 14205744 [02:19] Libelula\SinRespeto
Aguila}Insufrible has acertado 6 seguidas!! Puntos HOY: 88308, SEMANA: 17877307 y MES: 14205744
[02:20] Libelula\SinRespeto For The Competitive Edge type !pingme [02:20] Libelula\SinRespeto
For The Competitive Edge type !pingme
[02:20] Libelula\SinRespeto Tri.4800 Cotilleo-TVɂRUJI˿COMOuSEuLLAMAuELuCANALuDEuCANALuSATELITEuDIGITALuDEDICADOuALuMISTERIOuYuTERRORu?u [02:20] Libelula\SinRespeto
Tri.4800 Cotilleo-TVɂRUJI˿COMOuSEuLLAMAuELuCANALuDEuCANALuSATELITEuDIGITALuDEDICADOuALuMISTERIOuYuTERRORu?u
[02:20] Libelula\SinRespeto 1 Pista: ***** ** Valor pregunta : 16711 Puntos [02:20] Libelula\SinRespeto
1 Pista: ***** ** Valor pregunta : 16711 Puntos
[02:20] Libelula\SinRespeto 2 Pista: cal** ** 30 segundos y 16711 Puntos [02:20] Libelula\SinRespeto
2 Pista: cal** ** 30 segundos y 16711 Puntos
[02:20] Libelula\SinRespeto 3 Pista: cal*e ** 15 segundos y 16711 Puntos [02:20] Libelula\SinRespeto
3 Pista: cal*e ** 15 segundos y 16711 Puntos
[02:20] Aguila}Insufrible calle 13 [02:20] Aguila}Insufrible
calle 13
[02:20] Libelula\SinRespeto �Increible!! Aguila}Insufrible contest󺠃04"calle 13" en �3.625 segundos, y ha ganado �6711�12 puntos [02:20] Libelula\SinRespeto
�Increible!! Aguila}Insufrible contest󺠃04"calle 13" en �3.625 segundos, y ha ganado �6711�12 puntos
[02:20] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:20] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:20] Libelula\SinRespeto Aguila}Insufrible has acertado 7 seguidas!! Puntos HOY: 105019, SEMANA: 17894018 y MES: 14222455 [02:20] Libelula\SinRespeto
Aguila}Insufrible has acertado 7 seguidas!! Puntos HOY: 105019, SEMANA: 17894018 y MES: 14222455
[02:20] Libelula\SinRespeto Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [02:20] Libelula\SinRespeto
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[02:20] Libelula\SinRespeto Tri.13718 Miscelaneaɓebosin˿(Religi󮩃󭯃01sseqllamamlamdoctrinamcr�camdeqloserabinoseacercamdelstextosdeqlamBiblia?y?y [02:20] Libelula\SinRespeto
Tri.13718 Miscelaneaɓebosin˿(Religi󮩃󭯃01sseqllamamlamdoctrinamcr�camdeqloserabinoseacercamdelstextosdeqlamBiblia?y?y
[02:20] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 20196 Puntos [02:20] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 20196 Puntos
[02:21] Libelula\SinRespeto 2 Pista: mas*** 30 segundos y 20196 Puntos [02:21] Libelula\SinRespeto
2 Pista: mas*** 30 segundos y 20196 Puntos
[02:21] Libelula\SinRespeto 3 Pista: maso*a 15 segundos y 20196 Puntos [02:21] Libelula\SinRespeto
3 Pista: maso*a 15 segundos y 20196 Puntos
[02:21] Libelula\SinRespeto Tiempo! La respuesta es -> masora <- [02:21] Libelula\SinRespeto
Tiempo! La respuesta es -> masora <-
[02:21] Libelula\SinRespeto R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 14222455 #4: Cocodrilo-ConPrisa 13963595 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3677435 #9: LaCamelia 3029384 #10: Karen 1224969 [02:21] Libelula\SinRespeto
R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 14222455 #4: Cocodrilo-ConPrisa 13963595 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3677435 #9: LaCamelia 3029384 #10: Karen 1224969
[02:21] Libelula\SinRespeto Tri.9618 LiteraturaɉRC-Domain˿Autorndee"azteca"e?e [02:21] Libelula\SinRespeto
Tri.9618 LiteraturaɉRC-Domain˿Autorndee"azteca"e?e
[02:21] Libelula\SinRespeto 1 Pista: **** ******** Valor pregunta : 23430 Puntos [02:21] Libelula\SinRespeto
1 Pista: **** ******** Valor pregunta : 23430 Puntos
[02:22] Libelula\SinRespeto 2 Pista: gar* ******** 30 segundos y 23430 Puntos [02:22] Libelula\SinRespeto
2 Pista: gar* ******** 30 segundos y 23430 Puntos
[02:22] LeonConPereza Bienvenido/a! Caracol_ConPereza [Admin] de .::RadioLuna::. [02:22] LeonConPereza
Bienvenido/a! Caracol_ConPereza [Admin] de .::RadioLuna::.
[02:22] Libelula\SinRespeto 3 Pista: gar* *e**i*** 15 segundos y 23430 Puntos [02:22] Libelula\SinRespeto
3 Pista: gar* *e**i*** 15 segundos y 23430 Puntos
[02:22] Libelula\SinRespeto Tiempo! La respuesta es -> gary�ennings <- [02:22] Libelula\SinRespeto
Tiempo! La respuesta es -> gary�ennings <-
[02:22] Libelula\SinRespeto Please refrain from using Extreme Bad Language [02:22] Libelula\SinRespeto
Please refrain from using Extreme Bad Language
[02:22] Libelula\SinRespeto Tri.3717 Eros-Sexɖonda˿Enbqu郰1l�nicalpel�laldemsuecarrera,ldirigidalporeFernandogColomo,lapareci󃰱ldesnudalcompletamentemlalactrizlAitanalSᮣhezlGij󮃰1b?l [02:22] Libelula\SinRespeto
Tri.3717 Eros-Sexɖonda˿Enbqu郰1l�nicalpel�laldemsuecarrera,ldirigidalporeFernandogColomo,lapareci󃰱ldesnudalcompletamentemlalactrizlAitanalSᮣhezlGij󮃰1b?l
[02:22] Libelula\SinRespeto 1 Pista: ******* ** **** Valor pregunta : 17402 Puntos [02:22] Libelula\SinRespeto
1 Pista: ******* ** **** Valor pregunta : 17402 Puntos
[02:22] Caracol_ConPereza buenas noches [02:22] Caracol_ConPereza
buenas noches
[02:23] Libelula\SinRespeto 2 Pista: baj**** ** **** 30 segundos y 17402 Puntos [02:23] Libelula\SinRespeto
2 Pista: baj**** ** **** 30 segundos y 17402 Puntos
[02:23] Libelula\SinRespeto 3 Pista: baja**e a* *o*o 15 segundos y 17402 Puntos [02:23] Libelula\SinRespeto
3 Pista: baja**e a* *o*o 15 segundos y 17402 Puntos
[02:23] Culebra}Agil Caracol_ConPereza: buenas noches [02:23] Culebra}Agil
Caracol_ConPereza: buenas noches
[02:23] Libelula\SinRespeto Tiempo! La respuesta es -> bajarse�l�oro <- [02:23] Libelula\SinRespeto
Tiempo! La respuesta es -> bajarse�l�oro <-
[02:23] Libelula\SinRespeto This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto [02:23] Libelula\SinRespeto
This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto
[02:23] Libelula\SinRespeto Tri.16558 Eros-SexɁker˿Lagaparici󮃰1udeuglᮤulasjmamariasjsupernumerariasj("pechogdeum᳢)fseuconoceuc󭯮..?f?f [02:23] Libelula\SinRespeto
Tri.16558 Eros-SexɁker˿Lagaparici󮃰1udeuglᮤulasjmamariasjsupernumerariasj("pechogdeum᳢)fseuconoceuc󭯮..?f?f
[02:23] Libelula\SinRespeto 1 Pista: ********** Valor pregunta : 22101 Puntos [02:23] Libelula\SinRespeto
1 Pista: ********** Valor pregunta : 22101 Puntos
[02:24] Libelula\SinRespeto 2 Pista: pol******* 30 segundos y 22101 Puntos [02:24] Libelula\SinRespeto
2 Pista: pol******* 30 segundos y 22101 Puntos
[02:24] Libelula\SinRespeto 3 Pista: poli*a**ia 15 segundos y 22101 Puntos [02:24] Libelula\SinRespeto
3 Pista: poli*a**ia 15 segundos y 22101 Puntos
[02:24] Libelula\SinRespeto Tiempo! La respuesta es -> polimastia <- [02:24] Libelula\SinRespeto
Tiempo! La respuesta es -> polimastia <-
[02:24] Libelula\SinRespeto This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 552740 #19: karen-62 535210 #20: Carlos_55 468075 [02:24] Libelula\SinRespeto
This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 552740 #19: karen-62 535210 #20: Carlos_55 468075
[02:24] Libelula\SinRespeto Tri.1931 Literaturaɇlaston˿AntoniosMachadosten�01mdosoalteroegos,oJuanedeuMairenamy...o?o [02:24] Libelula\SinRespeto
Tri.1931 Literaturaɇlaston˿AntoniosMachadosten�01mdosoalteroegos,oJuanedeuMairenamy...o?o
[02:24] Libelula\SinRespeto 1 Pista: **** ****** Valor pregunta : 5780 Puntos [02:24] Libelula\SinRespeto
1 Pista: **** ****** Valor pregunta : 5780 Puntos
[02:25] Libelula\SinRespeto 2 Pista: abe* ****** 30 segundos y 5780 Puntos [02:25] Libelula\SinRespeto
2 Pista: abe* ****** 30 segundos y 5780 Puntos
[02:25] Libelula\SinRespeto 3 Pista: abe* *a**i* 15 segundos y 5780 Puntos [02:25] Libelula\SinRespeto
3 Pista: abe* *a**i* 15 segundos y 5780 Puntos
[02:25] Libelula\SinRespeto Tiempo! La respuesta es -> abel�artin <- [02:25] Libelula\SinRespeto
Tiempo! La respuesta es -> abel�artin <-
[02:25] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [02:25] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[02:25] Libelula\SinRespeto Tri.10227 HistoriaɍARdeJAVA˿CU�oFUEoLAoPRIMERAoREPڂLICAoNEGRAoQUEoCONSIGUIӃ01oLAoINDEPENDENCIAoDEoUNAoPOTENCIAoEUROPEAoHACEo200oAяS?o?o [02:25] Libelula\SinRespeto
Tri.10227 HistoriaɍARdeJAVA˿CU�oFUEoLAoPRIMERAoREPڂLICAoNEGRAoQUEoCONSIGUIӃ01oLAoINDEPENDENCIAoDEoUNAoPOTENCIAoEUROPEAoHACEo200oAяS?o?o
[02:25] Libelula\SinRespeto 1 Pista: ***** Valor pregunta : 6155 Puntos [02:25] Libelula\SinRespeto
1 Pista: ***** Valor pregunta : 6155 Puntos
[02:26] Libelula\SinRespeto 2 Pista: hai** 30 segundos y 6155 Puntos [02:26] Libelula\SinRespeto
2 Pista: hai** 30 segundos y 6155 Puntos
[02:26] LeonConPereza Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas [02:26] LeonConPereza
Emitiendo ( AutoDJMix ) | Lugar ( RLDM ) | Temática ( Music Mix ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Peticiones: cerradas
[02:26] Libelula\SinRespeto 3 Pista: hai*i 15 segundos y 6155 Puntos [02:26] Libelula\SinRespeto
3 Pista: hai*i 15 segundos y 6155 Puntos
[02:26] Libelula\SinRespeto Tiempo! La respuesta es -> haiti <- [02:26] Libelula\SinRespeto
Tiempo! La respuesta es -> haiti <-
[02:26] Libelula\SinRespeto This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 572184 #15: Aguila-Especial 543035 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704 [02:26] Libelula\SinRespeto
This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 572184 #15: Aguila-Especial 543035 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704
[02:26] Libelula\SinRespeto Tri.3812 Politicaɭ˿Enuqu郰1gciudadhespa񯬡wserpublicawelndiariok"ElnPeri󤩣ok?g [02:26] Libelula\SinRespeto
Tri.3812 Politicaɭ˿Enuqu郰1gciudadhespa񯬡wserpublicawelndiariok"ElnPeri󤩣ok?g
[02:26] Libelula\SinRespeto 1 Pista: ********* Valor pregunta : 9364 Puntos [02:26] Libelula\SinRespeto
1 Pista: ********* Valor pregunta : 9364 Puntos
[02:27] Libelula\SinRespeto 2 Pista: bar****** 30 segundos y 9364 Puntos [02:27] Libelula\SinRespeto
2 Pista: bar****** 30 segundos y 9364 Puntos
[02:27] Culebra}Agil Barcelona [02:27] Culebra}Agil
Barcelona
[02:27] Libelula\SinRespeto �Enhorabuena Culebra}Agil!! Has contestado "Barcelona" y por ello has ganado �364�12 puntos [02:27] Libelula\SinRespeto
�Enhorabuena Culebra}Agil!! Has contestado "Barcelona" y por ello has ganado �364�12 puntos
[02:27] Libelula\SinRespeto ACTION awards Culebra}Agil with a +v for having over 15000 points [02:27] Libelula\SinRespeto
ACTION awards Culebra}Agil with a +v for having over 15000 points
[02:27] Libelula\SinRespeto Culebra}Agil has acertado 1 seguidas!! Puntos HOY: 21944, SEMANA: 10741018 y MES: 581548 [02:27] Libelula\SinRespeto
Culebra}Agil has acertado 1 seguidas!! Puntos HOY: 21944, SEMANA: 10741018 y MES: 581548
[02:27] Libelula\SinRespeto R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0 [02:27] Libelula\SinRespeto
R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0
[02:27] Libelula\SinRespeto Tri.12394 Geografiaɓebosin˿Enbqu郰1tislaasetencuentraaelzparquetnacionalzdetTimanfaya?t?t [02:27] Libelula\SinRespeto
Tri.12394 Geografiaɓebosin˿Enbqu郰1tislaasetencuentraaelzparquetnacionalzdetTimanfaya?t?t
[02:27] Libelula\SinRespeto 1 Pista: ********* Valor pregunta : 21942 Puntos [02:27] Libelula\SinRespeto
1 Pista: ********* Valor pregunta : 21942 Puntos
[02:27] Libelula\SinRespeto 2 Pista: lan****** 30 segundos y 21942 Puntos [02:27] Libelula\SinRespeto
2 Pista: lan****** 30 segundos y 21942 Puntos
[02:27] Libelula\SinRespeto 3 Pista: lan*a*o*e 15 segundos y 21942 Puntos [02:27] Libelula\SinRespeto
3 Pista: lan*a*o*e 15 segundos y 21942 Puntos
[02:28] Libelula\SinRespeto Tiempo! La respuesta es -> lanzarote <- [02:28] Libelula\SinRespeto
Tiempo! La respuesta es -> lanzarote <-
[02:28] Libelula\SinRespeto Top10 Players ( Weekly & Monthly ) are Auto-Voiced [02:28] Libelula\SinRespeto
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[02:28] Libelula\SinRespeto Tri.10258 Cineɴovarich˿DUOpCREADORpDEpTOMpYpJERRYpYpDEpLOSpPICAPIEDRAp?p [02:28] Libelula\SinRespeto
Tri.10258 Cineɴovarich˿DUOpCREADORpDEpTOMpYpJERRYpYpDEpLOSpPICAPIEDRAp?p
[02:28] Libelula\SinRespeto 1 Pista: ***** ******* Valor pregunta : 20640 Puntos [02:28] Libelula\SinRespeto
1 Pista: ***** ******* Valor pregunta : 20640 Puntos
[02:28] Libelula\SinRespeto �Muy bien Aguila}Insufrible!! Acertaste "hanna barbera" en tan s󬯠�1.297 segundos y por eso has ganado: �0640�12 puntos [02:28] Libelula\SinRespeto
�Muy bien Aguila}Insufrible!! Acertaste "hanna barbera" en tan s󬯠�1.297 segundos y por eso has ganado: �0640�12 puntos
[02:28] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:28] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:28] Libelula\SinRespeto Aguila}Insufrible has acertado 1 seguidas!! Puntos HOY: 125659, SEMANA: 17914658 y MES: 14243095 [02:28] Libelula\SinRespeto
Aguila}Insufrible has acertado 1 seguidas!! Puntos HOY: 125659, SEMANA: 17914658 y MES: 14243095
[02:28] Aguila}Insufrible hanna barbera [02:28] Aguila}Insufrible
hanna barbera
[02:28] Libelula\SinRespeto Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [02:28] Libelula\SinRespeto
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[02:28] Libelula\SinRespeto Tri.5197 Geografiaɰacodeon˿GranwlagououmarninteriornentrerEuroparyhAsiar:s?s [02:28] Libelula\SinRespeto
Tri.5197 Geografiaɰacodeon˿GranwlagououmarninteriornentrerEuroparyhAsiar:s?s
[02:28] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 15065 Puntos [02:28] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 15065 Puntos
[02:29] Libelula\SinRespeto 2 Pista: cas*** 30 segundos y 15065 Puntos [02:29] Libelula\SinRespeto
2 Pista: cas*** 30 segundos y 15065 Puntos
[02:29] Cocodrilo-ConPrisa caspio [02:29] Cocodrilo-ConPrisa
caspio
[02:29] Libelula\SinRespeto �Bingo!! Cocodrilo-ConPrisa dio la respuesta: "caspio" en �1.109 segundos e incrementa sus ganancias con �5065�12 puntos [02:29] Libelula\SinRespeto
�Bingo!! Cocodrilo-ConPrisa dio la respuesta: "caspio" en �1.109 segundos e incrementa sus ganancias con �5065�12 puntos
[02:29] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 1 seguidas!! Puntos HOY: 479683, SEMANA: 13978660 y MES: 13978660 [02:29] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 1 seguidas!! Puntos HOY: 479683, SEMANA: 13978660 y MES: 13978660
[02:29] Libelula\SinRespeto R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 17914658 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 13978660 #5: Culebra}Agil 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3677435 [02:29] Libelula\SinRespeto
R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 17914658 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 13978660 #5: Culebra}Agil 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3677435
[02:29] Libelula\SinRespeto Tri.10454 Politicaɩfen˿DirigentendellPartidohPopularbentrenFragamycAznarb(apellidos)s?s [02:29] Libelula\SinRespeto
Tri.10454 Politicaɩfen˿DirigentendellPartidohPopularbentrenFragamycAznarb(apellidos)s?s
[02:29] Libelula\SinRespeto 1 Pista: ********* ****** Valor pregunta : 15277 Puntos [02:29] Libelula\SinRespeto
1 Pista: ********* ****** Valor pregunta : 15277 Puntos
[02:29] LeonConPereza Bienvenido/a! Aguila-Especial [Founder] de .::RadioLuna::. [02:29] LeonConPereza
Bienvenido/a! Aguila-Especial [Founder] de .::RadioLuna::.
[02:29] Libelula\SinRespeto 2 Pista: her****** ****** 30 segundos y 15277 Puntos [02:29] Libelula\SinRespeto
2 Pista: her****** ****** 30 segundos y 15277 Puntos
[02:29] Libelula\SinRespeto 3 Pista: her*a**e* *a***a 15 segundos y 15277 Puntos [02:29] Libelula\SinRespeto
3 Pista: her*a**e* *a***a 15 segundos y 15277 Puntos
[02:29] Hipopotamo}Breve [EstrellaDeMar\Pedante] cosita buena muacksssssssssssssssssssssssssssssssssss [02:29] Hipopotamo}Breve
[EstrellaDeMar\Pedante] cosita buena muacksssssssssssssssssssssssssssssssssss
[02:30] Hipopotamo}Breve y ya vi al otro [02:30] Hipopotamo}Breve
y ya vi al otro
[02:30] Hipopotamo}Breve hi [02:30] Hipopotamo}Breve
hi
[02:30] Aguila}Insufrible holaaaa [02:30] Aguila}Insufrible
holaaaa
[02:30] Libelula\SinRespeto Tiempo! La respuesta es -> hernandez�ancha <- [02:30] Libelula\SinRespeto
Tiempo! La respuesta es -> hernandez�ancha <-
[02:30] Libelula\SinRespeto We feature over 50,000 Q&A ! [02:30] Libelula\SinRespeto
We feature over 50,000 Q&A !
[02:30] Libelula\SinRespeto Tri.17672 Politicaɩfen˿C󭯃01lserllamaslasalcaldesasdercordobasenh2000k?k [02:30] Libelula\SinRespeto
Tri.17672 Politicaɩfen˿C󭯃01lserllamaslasalcaldesasdercordobasenh2000k?k
[02:30] Libelula\SinRespeto 1 Pista: **** ******* Pregunta de BONUS : 50000 Puntos [02:30] Libelula\SinRespeto
1 Pista: **** ******* Pregunta de BONUS : 50000 Puntos
[02:30] Libelula\SinRespeto 2 Pista: ros* ******* 30 segundos y 50000 Puntos [02:30] Libelula\SinRespeto
2 Pista: ros* ******* 30 segundos y 50000 Puntos
[02:30] EstrellaDeMar\Pedante [Hipopotamo}Breve] Cosita rica, muuuaaackkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk. Cosita buena, cosita bien hecha. [02:30] EstrellaDeMar\Pedante
[Hipopotamo}Breve] Cosita rica, muuuaaackkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk. Cosita buena, cosita bien hecha.
[02:30] Aguila}Insufrible te quiere besar la cosita [02:30] Aguila}Insufrible
te quiere besar la cosita
[02:30] Libelula\SinRespeto 3 Pista: rosa a*ui*a* 15 segundos y 50000 Puntos [02:30] Libelula\SinRespeto
3 Pista: rosa a*ui*a* 15 segundos y 50000 Puntos
[02:30] Libelula\SinRespeto �e nota que sabes mucho de esto Aguila}Insufrible! Tu respuesta "rosa aguilar" es correcta y ganas �0000�12 puntos [02:30] Libelula\SinRespeto
�e nota que sabes mucho de esto Aguila}Insufrible! Tu respuesta "rosa aguilar" es correcta y ganas �0000�12 puntos
[02:30] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:30] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:30] Libelula\SinRespeto Aguila}Insufrible has acertado 1 seguidas!! Puntos HOY: 175659, SEMANA: 17964658 y MES: 14293095 [02:30] Libelula\SinRespeto
Aguila}Insufrible has acertado 1 seguidas!! Puntos HOY: 175659, SEMANA: 17964658 y MES: 14293095
[02:30] Aguila}Insufrible rosa aguilar [02:30] Aguila}Insufrible
rosa aguilar
[02:31] Hipopotamo}Breve [EstrellaDeMar\Pedante] puede besarme donde guste [02:31] Hipopotamo}Breve
[EstrellaDeMar\Pedante] puede besarme donde guste
[02:31] Aguila}Insufrible jajaajajajaj [02:31] Aguila}Insufrible
jajaajajajaj
[02:31] Libelula\SinRespeto Tri.13123 Personajesɤisney˿(Dibujos)߅lccandelabrovdez"lapBellapyylapBestia"?w?w [02:31] Libelula\SinRespeto
Tri.13123 Personajesɤisney˿(Dibujos)߅lccandelabrovdez"lapBellapyylapBestia"?w?w
[02:31] Libelula\SinRespeto 1 Pista: ******* Pregunta de BONUS : 200000 Puntos [02:31] Libelula\SinRespeto
1 Pista: ******* Pregunta de BONUS : 200000 Puntos
[02:31] Libelula\SinRespeto �Enhorabuena Aguila}Insufrible!! Has contestado "lumiere" y por ello has ganado �00000�12 puntos [02:31] Libelula\SinRespeto
�Enhorabuena Aguila}Insufrible!! Has contestado "lumiere" y por ello has ganado �00000�12 puntos
[02:31] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:31] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:31] Libelula\SinRespeto Aguila}Insufrible has acertado 2 seguidas!! Puntos HOY: 375659, SEMANA: 18164658 y MES: 14493095 [02:31] Libelula\SinRespeto
Aguila}Insufrible has acertado 2 seguidas!! Puntos HOY: 375659, SEMANA: 18164658 y MES: 14493095
[02:31] Aguila}Insufrible lumiere [02:31] Aguila}Insufrible
lumiere
[02:31] EstrellaDeMar\Pedante Mis partes favoritas, en donde no te pega el sol, mamacita. [02:31] EstrellaDeMar\Pedante
Mis partes favoritas, en donde no te pega el sol, mamacita.
[02:31] Libelula\SinRespeto Tri.6539 InformaticaɌucky_LuK˿LAiULTIMAiVERSIONiDELi3DiSTUDIOiENiDOSiFUEiLAiNUMERO...i?i [02:31] Libelula\SinRespeto
Tri.6539 InformaticaɌucky_LuK˿LAiULTIMAiVERSIONiDELi3DiSTUDIOiENiDOSiFUEiLAiNUMERO...i?i
[02:31] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 17557 Puntos [02:31] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 17557 Puntos
[02:31] Aguila}Insufrible a mi si me pega el sol ahi [02:31] Aguila}Insufrible
a mi si me pega el sol ahi
[02:31] EstrellaDeMar\Pedante ACTION la besa en la planta de los pies... [02:31] EstrellaDeMar\Pedante
ACTION la besa en la planta de los pies...
[02:31] EstrellaDeMar\Pedante [Aguila}Insufrible] Al menos salude. [02:31] EstrellaDeMar\Pedante
[Aguila}Insufrible] Al menos salude.
[02:31] Libelula\SinRespeto 2 Pista: cua*** 30 segundos y 17557 Puntos [02:31] Libelula\SinRespeto
2 Pista: cua*** 30 segundos y 17557 Puntos
[02:32] Aguila}Insufrible jajajaj EstrellaDeMar\Pedante veennn para abrazarte y beso [02:32] Aguila}Insufrible
jajajaj EstrellaDeMar\Pedante veennn para abrazarte y beso
[02:32] Libelula\SinRespeto 3 Pista: cua**o 15 segundos y 17557 Puntos [02:32] Libelula\SinRespeto
3 Pista: cua**o 15 segundos y 17557 Puntos
[02:32] Aguila}Insufrible cuatro [02:32] Aguila}Insufrible
cuatro
[02:32] Libelula\SinRespeto �Increible!! Aguila}Insufrible contest󺠃04"cuatro" en �0.312 segundos, y ha ganado �7557�12 puntos [02:32] Libelula\SinRespeto
�Increible!! Aguila}Insufrible contest󺠃04"cuatro" en �0.312 segundos, y ha ganado �7557�12 puntos
[02:32] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:32] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:32] Libelula\SinRespeto Aguila}Insufrible has acertado 3 seguidas!! Puntos HOY: 393216, SEMANA: 18182215 y MES: 14510652 [02:32] Libelula\SinRespeto
Aguila}Insufrible has acertado 3 seguidas!! Puntos HOY: 393216, SEMANA: 18182215 y MES: 14510652
[02:32] Hipopotamo}Breve calmate [02:32] Hipopotamo}Breve
calmate
[02:32] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [02:32] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[02:32] Libelula\SinRespeto Tri.13371 Economiaɬusieˍonedasbdeltmundo:lMonedabdeaTurkmenistanu?l [02:32] Libelula\SinRespeto
Tri.13371 Economiaɬusieˍonedasbdeltmundo:lMonedabdeaTurkmenistanu?l
[02:32] Libelula\SinRespeto 1 Pista: ***** Valor pregunta : 10840 Puntos [02:32] Libelula\SinRespeto
1 Pista: ***** Valor pregunta : 10840 Puntos
[02:32] Hipopotamo}Breve [EstrellaDeMar\Pedante] es mia [02:32] Hipopotamo}Breve
[EstrellaDeMar\Pedante] es mia
[02:32] Aguila}Insufrible jajajajaja [02:32] Aguila}Insufrible
jajajajaja
[02:32] EstrellaDeMar\Pedante Deje las confiancitas, de lejitos tambi鮠puede saludar. Liso, [Aguila}Insufrible] [02:32] EstrellaDeMar\Pedante
Deje las confiancitas, de lejitos tambi鮠puede saludar. Liso, [Aguila}Insufrible]
[02:32] Aguila}Insufrible jajajajajajaj [02:32] Aguila}Insufrible
jajajajajajaj
[02:32] Libelula\SinRespeto 2 Pista: man** 30 segundos y 10840 Puntos [02:32] Libelula\SinRespeto
2 Pista: man** 30 segundos y 10840 Puntos
[02:32] EstrellaDeMar\Pedante Mis carnes tiernitas solo son de [Hipopotamo}Breve] [02:32] EstrellaDeMar\Pedante
Mis carnes tiernitas solo son de [Hipopotamo}Breve]
[02:32] Libelula\SinRespeto 3 Pista: mana* 15 segundos y 10840 Puntos [02:32] Libelula\SinRespeto
3 Pista: mana* 15 segundos y 10840 Puntos
[02:33] Aguila}Insufrible un buen brisket [02:33] Aguila}Insufrible
un buen brisket
[02:33] Libelula\SinRespeto Tiempo! La respuesta es -> manat <- [02:33] Libelula\SinRespeto
Tiempo! La respuesta es -> manat <-
[02:33] Hipopotamo}Breve y las duritas tambien [02:33] Hipopotamo}Breve
y las duritas tambien
[02:33] Hipopotamo}Breve xD [02:33] Hipopotamo}Breve
xD
[02:33] Libelula\SinRespeto R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0 [02:33] Libelula\SinRespeto
R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0
[02:33] Libelula\SinRespeto Tri.10740 Fisica-Quimicaɑuique˿Descubridorjdelfgascdellagrisa.eLoiprimeroiquelhizoielftipoifuelrespirarloiyydescojonarse...absolutamentelver�co...e?e [02:33] Libelula\SinRespeto
Tri.10740 Fisica-Quimicaɑuique˿Descubridorjdelfgascdellagrisa.eLoiprimeroiquelhizoielftipoifuelrespirarloiyydescojonarse...absolutamentelver�co...e?e
[02:33] Libelula\SinRespeto 1 Pista: ******* **** Pregunta de BONUS : 50000 Puntos [02:33] Libelula\SinRespeto
1 Pista: ******* **** Pregunta de BONUS : 50000 Puntos
[02:33] Libelula\SinRespeto 2 Pista: hum**** **** 30 segundos y 50000 Puntos [02:33] Libelula\SinRespeto
2 Pista: hum**** **** 30 segundos y 50000 Puntos
[02:33] EstrellaDeMar\Pedante Esas, tienen tu firma. [02:33] EstrellaDeMar\Pedante
Esas, tienen tu firma.
[02:33] LeonConPereza .::RadioLuna::. Comienza DJ: ( Caracol_ConPereza ) | Temática: Música Variada [02:33] LeonConPereza
.::RadioLuna::. Comienza DJ: ( Caracol_ConPereza ) | Temática: Música Variada
[02:33] Libelula\SinRespeto 3 Pista: hum**** *a** 15 segundos y 50000 Puntos [02:33] Libelula\SinRespeto
3 Pista: hum**** *a** 15 segundos y 50000 Puntos
[02:33] EstrellaDeMar\Pedante xD... Ok, no. [02:33] EstrellaDeMar\Pedante
xD... Ok, no.
[02:33] Aguila-Especial !tema [02:33] Aguila-Especial
!tema
[02:33] LeonConPereza Sonando: Dj Online | Temática: Música Variada | Sintoniza: www.radiolunademiel.com [02:33] LeonConPereza
Sonando: Dj Online | Temática: Música Variada | Sintoniza: www.radiolunademiel.com
[02:33] Aguila}Insufrible no se les antoja tirarse con un pomo de helado de chocolate? [02:33] Aguila}Insufrible
no se les antoja tirarse con un pomo de helado de chocolate?
[02:33] Libelula\SinRespeto Tiempo! La respuesta es -> humphry�avy <- [02:33] Libelula\SinRespeto
Tiempo! La respuesta es -> humphry�avy <-
[02:34] Hipopotamo}Breve prefiero de vainilla [02:34] Hipopotamo}Breve
prefiero de vainilla
[02:34] Aguila}Insufrible a m�e encanta el chocolate me pone bien chido [02:34] Aguila}Insufrible
a m�e encanta el chocolate me pone bien chido
[02:34] Libelula\SinRespeto If you think a Q&A is wrong, please call an OP [02:34] Libelula\SinRespeto
If you think a Q&A is wrong, please call an OP
[02:34] Libelula\SinRespeto Tri.5013 Arteɖivian˿D󮤥oseopuedeovisitaraelg"MuseoaBolivariano"?t?t [02:34] Libelula\SinRespeto
Tri.5013 Arteɖivian˿D󮤥oseopuedeovisitaraelg"MuseoaBolivariano"?t?t
[02:34] Libelula\SinRespeto 1 Pista: ******* Valor pregunta : 11565 Puntos [02:34] Libelula\SinRespeto
1 Pista: ******* Valor pregunta : 11565 Puntos
[02:34] Libelula\SinRespeto �Eso es Aguila}Insufrible!! Dijiste: "caracas" y ello te ha valido: �1565�12 puntos [02:34] Libelula\SinRespeto
�Eso es Aguila}Insufrible!! Dijiste: "caracas" y ello te ha valido: �1565�12 puntos
[02:34] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:34] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:34] Libelula\SinRespeto Aguila}Insufrible has acertado 4 seguidas!! Puntos HOY: 404781, SEMANA: 18193780 y MES: 14522217 [02:34] Libelula\SinRespeto
Aguila}Insufrible has acertado 4 seguidas!! Puntos HOY: 404781, SEMANA: 18193780 y MES: 14522217
[02:34] Aguila}Insufrible caracas [02:34] Aguila}Insufrible
caracas
[02:34] Aguila-Especial !tema [02:34] Aguila-Especial
!tema
[02:34] LeonConPereza Sonando: Dj Online | Temática: Música Variada | Sintoniza: www.radiolunademiel.com [02:34] LeonConPereza
Sonando: Dj Online | Temática: Música Variada | Sintoniza: www.radiolunademiel.com
[02:34] Libelula\SinRespeto R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0 [02:34] Libelula\SinRespeto
R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0
[02:34] Libelula\SinRespeto Tri.2388 Biologiaɳtephenwo˿Cuᬃ01cesxelcmayorrantilopekquekllegatatpesarrunattonelada?o?o [02:34] Libelula\SinRespeto
Tri.2388 Biologiaɳtephenwo˿Cuᬃ01cesxelcmayorrantilopekquekllegatatpesarrunattonelada?o?o
[02:34] Libelula\SinRespeto 1 Pista: **** ******** Valor pregunta : 20738 Puntos [02:34] Libelula\SinRespeto
1 Pista: **** ******** Valor pregunta : 20738 Puntos
[02:34] Aguila}Insufrible !tema [02:34] Aguila}Insufrible
!tema
[02:34] LeonConPereza Sonando: Dj Online | Temática: Música Variada | Sintoniza: www.radiolunademiel.com [02:34] LeonConPereza
Sonando: Dj Online | Temática: Música Variada | Sintoniza: www.radiolunademiel.com
[02:34] Hipopotamo}Breve me gusta el chocolate, pero no en helado [02:34] Hipopotamo}Breve
me gusta el chocolate, pero no en helado
[02:34] LeonConPereza ADMIN Caracol_ConPereza Abre las peticiones en .::RadioLuna::. LeonConPereza a partir de este momento pide tu tema con el comando: !tocame Tema - Artista [02:34] LeonConPereza
ADMIN Caracol_ConPereza Abre las peticiones en .::RadioLuna::. LeonConPereza a partir de este momento pide tu tema con el comando: !tocame Tema - Artista
[02:34] Libelula\SinRespeto 2 Pista: alc* ******** 30 segundos y 20738 Puntos [02:34] Libelula\SinRespeto
2 Pista: alc* ******** 30 segundos y 20738 Puntos
[02:34] EstrellaDeMar\Pedante Por eso te gusto yo, xD [02:34] EstrellaDeMar\Pedante
Por eso te gusto yo, xD
[02:35] Hipopotamo}Breve zatamente [02:35] Hipopotamo}Breve
zatamente
[02:35] Libelula\SinRespeto 3 Pista: alce a**i*a*o 15 segundos y 20738 Puntos [02:35] Libelula\SinRespeto
3 Pista: alce a**i*a*o 15 segundos y 20738 Puntos
[02:35] Aguila}Insufrible que buena barrita de milkiway tienes [02:35] Aguila}Insufrible
que buena barrita de milkiway tienes
[02:35] EstrellaDeMar\Pedante [Aguila}Insufrible] eres muy desabrido. Ya, perdiste contra m�xD [02:35] EstrellaDeMar\Pedante
[Aguila}Insufrible] eres muy desabrido. Ya, perdiste contra m�xD
[02:35] Aguila}Insufrible jajajajajajaja [02:35] Aguila}Insufrible
jajajajajajaja
[02:35] Hipopotamo}Breve no me gusta el milkyway [02:35] Hipopotamo}Breve
no me gusta el milkyway
[02:35] Libelula\SinRespeto Tiempo! La respuesta es -> alce�fricano <- [02:35] Libelula\SinRespeto
Tiempo! La respuesta es -> alce�fricano <-
[02:35] Aguila}Insufrible es el poder de la barrita [02:35] Aguila}Insufrible
es el poder de la barrita
[02:35] Libelula\SinRespeto For The Competitive Edge type !pingme [02:35] Libelula\SinRespeto
For The Competitive Edge type !pingme
[02:35] Libelula\SinRespeto Tri.18870 Medicina-Saludɬusie˅lucuerpodhumano:e߁rteriashquehaportanzsangrehoxigenadajajloshbrazos?e?e [02:35] Libelula\SinRespeto
Tri.18870 Medicina-Saludɬusie˅lucuerpodhumano:e߁rteriashquehaportanzsangrehoxigenadajajloshbrazos?e?e
[02:35] Libelula\SinRespeto 1 Pista: ********** Valor pregunta : 11149 Puntos [02:35] Libelula\SinRespeto
1 Pista: ********** Valor pregunta : 11149 Puntos
[02:35] EstrellaDeMar\Pedante Mejor omito mis comentarios, [Aguila}Insufrible] . Jajajajajajajajajajajaja [02:35] EstrellaDeMar\Pedante
Mejor omito mis comentarios, [Aguila}Insufrible] . Jajajajajajajajajajajaja
[02:35] Libelula\SinRespeto 2 Pista: sub******* 30 segundos y 11149 Puntos [02:35] Libelula\SinRespeto
2 Pista: sub******* 30 segundos y 11149 Puntos
[02:35] Aguila}Insufrible jajajaj dilos [02:35] Aguila}Insufrible
jajajaj dilos
[02:35] Aguila-Especial !tocame madonna-like a player [02:35] Aguila-Especial
!tocame madonna-like a player
[02:35] LeonConPereza Tema Aceptado con exito Aguila-Especial en un momento mas la escucharas[214] [02:35] LeonConPereza
Tema Aceptado con exito Aguila-Especial en un momento mas la escucharas[214]
[02:35] Aguila}Insufrible si son materia de ban, mejor [02:35] Aguila}Insufrible
si son materia de ban, mejor
[02:36] Libelula\SinRespeto 3 Pista: sub**a*ia* 15 segundos y 11149 Puntos [02:36] Libelula\SinRespeto
3 Pista: sub**a*ia* 15 segundos y 11149 Puntos
[02:36] Libelula\SinRespeto Tiempo! La respuesta es -> subclavias <- [02:36] Libelula\SinRespeto
Tiempo! La respuesta es -> subclavias <-
[02:36] EstrellaDeMar\Pedante [Aguila}Insufrible] A m�e importa poco los ban. xD [02:36] EstrellaDeMar\Pedante
[Aguila}Insufrible] A m�e importa poco los ban. xD
[02:36] Aguila}Insufrible yo quiero ir a unos lugares aqui en mi rancho que se llaman bbq [02:36] Aguila}Insufrible
yo quiero ir a unos lugares aqui en mi rancho que se llaman bbq
[02:36] Libelula\SinRespeto Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [02:36] Libelula\SinRespeto
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[02:36] Libelula\SinRespeto Tri.9418 MitologiaɆrigotora˿Diosajn󲤩cajqueymontabajenyunycarrortiradorporvgatos?h?h [02:36] Libelula\SinRespeto
Tri.9418 MitologiaɆrigotora˿Diosajn󲤩cajqueymontabajenyunycarrortiradorporvgatos?h?h
[02:36] Libelula\SinRespeto 1 Pista: ***** Valor pregunta : 12114 Puntos [02:36] Libelula\SinRespeto
1 Pista: ***** Valor pregunta : 12114 Puntos
[02:36] Aguila}Insufrible unas carnes bien ponedoras [02:36] Aguila}Insufrible
unas carnes bien ponedoras
[02:36] EstrellaDeMar\Pedante Solo que mis comentarios es mejor decirlos en el oscurito a [Hipopotamo}Breve] [02:36] EstrellaDeMar\Pedante
Solo que mis comentarios es mejor decirlos en el oscurito a [Hipopotamo}Breve]
[02:36] Aguila}Insufrible que le sacas la costilla con facilidad de lo tiernito [02:36] Aguila}Insufrible
que le sacas la costilla con facilidad de lo tiernito
[02:36] Libelula\SinRespeto 2 Pista: fre** 30 segundos y 12114 Puntos [02:36] Libelula\SinRespeto
2 Pista: fre** 30 segundos y 12114 Puntos
[02:36] Aguila}Insufrible freia [02:36] Aguila}Insufrible
freia
[02:36] Aguila}Insufrible freya [02:36] Aguila}Insufrible
freya
[02:36] Libelula\SinRespeto �e nota que sabes mucho de esto Aguila}Insufrible! Tu respuesta "freya" es correcta y ganas �2114�12 puntos [02:36] Libelula\SinRespeto
�e nota que sabes mucho de esto Aguila}Insufrible! Tu respuesta "freya" es correcta y ganas �2114�12 puntos
[02:36] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:36] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:36] Libelula\SinRespeto Aguila}Insufrible has acertado 5 seguidas!! Puntos HOY: 416895, SEMANA: 18205894 y MES: 14534331 [02:36] Libelula\SinRespeto
Aguila}Insufrible has acertado 5 seguidas!! Puntos HOY: 416895, SEMANA: 18205894 y MES: 14534331
[02:37] Libelula\SinRespeto R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 14522217 #4: Cocodrilo-ConPrisa 13978660 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3677435 #9: LaCamelia 3029384 #10: Karen 1224969 [02:37] Libelula\SinRespeto
R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 14522217 #4: Cocodrilo-ConPrisa 13978660 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3677435 #9: LaCamelia 3029384 #10: Karen 1224969
[02:37] Libelula\SinRespeto Tri.10566 DeporteɔeLaRaNhA˿GanadorzdeleDakarz2002,xcategoriaqCOCHESx?x [02:37] Libelula\SinRespeto
Tri.10566 DeporteɔeLaRaNhA˿GanadorzdeleDakarz2002,xcategoriaqCOCHESx?x
[02:37] Libelula\SinRespeto 1 Pista: ******* ******* Valor pregunta : 23669 Puntos [02:37] Libelula\SinRespeto
1 Pista: ******* ******* Valor pregunta : 23669 Puntos
[02:37] Libelula\SinRespeto 2 Pista: hir**** ******* 30 segundos y 23669 Puntos [02:37] Libelula\SinRespeto
2 Pista: hir**** ******* 30 segundos y 23669 Puntos
[02:37] EstrellaDeMar\Pedante ߑu頶an a fre� Yo quiero. [02:37] EstrellaDeMar\Pedante
ߑu頶an a fre� Yo quiero.
[02:37] Libelula\SinRespeto 3 Pista: hiro**i *a*uo*a 15 segundos y 23669 Puntos [02:37] Libelula\SinRespeto
3 Pista: hiro**i *a*uo*a 15 segundos y 23669 Puntos
[02:37] Aguila}Insufrible ajajajaj [02:37] Aguila}Insufrible
ajajajaj
[02:37] Aguila}Insufrible andas de freidora, est᳠haciendo cena? [02:37] Aguila}Insufrible
andas de freidora, est᳠haciendo cena?
[02:37] Libelula\SinRespeto Tiempo! La respuesta es -> hiroshi�asuoka <- [02:37] Libelula\SinRespeto
Tiempo! La respuesta es -> hiroshi�asuoka <-
[02:38] Libelula\SinRespeto Please refrain from using Extreme Bad Language [02:38] Libelula\SinRespeto
Please refrain from using Extreme Bad Language
[02:38] Libelula\SinRespeto Tri.8175 GeografiaɍARdeJAVA˿DӎDEkVIVEkM�kDEkLAkMITADkDEkLAkPOBLACIӎkESTADOUNIDENSE,kENkELkESTEkOkENkELkOESTE?k?k [02:38] Libelula\SinRespeto
Tri.8175 GeografiaɍARdeJAVA˿DӎDEkVIVEkM�kDEkLAkMITADkDEkLAkPOBLACIӎkESTADOUNIDENSE,kENkELkESTEkOkENkELkOESTE?k?k
[02:38] Libelula\SinRespeto 1 Pista: ** ** **** Valor pregunta : 7428 Puntos [02:38] Libelula\SinRespeto
1 Pista: ** ** **** Valor pregunta : 7428 Puntos
[02:38] Hipopotamo}Breve me gustas con olor a fritanga [02:38] Hipopotamo}Breve
me gustas con olor a fritanga
[02:38] Hipopotamo}Breve ok, no xD [02:38] Hipopotamo}Breve
ok, no xD
[02:38] Libelula\SinRespeto 2 Pista: en�* **** 30 segundos y 7428 Puntos [02:38] Libelula\SinRespeto
2 Pista: en�* **** 30 segundos y 7428 Puntos
[02:38] Aguila}Insufrible en el este [02:38] Aguila}Insufrible
en el este
[02:38] Libelula\SinRespeto �Bingo!! Aguila}Insufrible dio la respuesta: "en el este" en �2.766 segundos e incrementa sus ganancias con �428�12 puntos [02:38] Libelula\SinRespeto
�Bingo!! Aguila}Insufrible dio la respuesta: "en el este" en �2.766 segundos e incrementa sus ganancias con �428�12 puntos
[02:38] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:38] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:38] Libelula\SinRespeto Aguila}Insufrible has acertado 6 seguidas!! Puntos HOY: 424323, SEMANA: 18213322 y MES: 14541759 [02:38] Libelula\SinRespeto
Aguila}Insufrible has acertado 6 seguidas!! Puntos HOY: 424323, SEMANA: 18213322 y MES: 14541759
[02:38] EstrellaDeMar\Pedante O sea, que [Aguila}Insufrible] parece un domingo de fritanga. [02:38] EstrellaDeMar\Pedante
O sea, que [Aguila}Insufrible] parece un domingo de fritanga.
[02:38] EstrellaDeMar\Pedante Con raz󮠴e gusta, jajajajajajajajajajajaja [02:38] EstrellaDeMar\Pedante
Con raz󮠴e gusta, jajajajajajajajajajajaja
[02:38] Hipopotamo}Breve jajajajajajajajaaaaaaaaaaaaaaaaaaaaaaa [02:38] Hipopotamo}Breve
jajajajajajajajaaaaaaaaaaaaaaaaaaaaaaa
[02:38] Libelula\SinRespeto This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto [02:38] Libelula\SinRespeto
This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto
[02:38] Libelula\SinRespeto Tri.10985 CineɌopes_˿HumpreylBogartuylGarylCooperjfueronanominadoszalcoscarjporjdoszpeliculaszdistintaszelcmismoha񯬃01vperohlatactrizveratlatmismatenalaszdos,vQuienaeratlatactrizv?v [02:38] Libelula\SinRespeto
Tri.10985 CineɌopes_˿HumpreylBogartuylGarylCooperjfueronanominadoszalcoscarjporjdoszpeliculaszdistintaszelcmismoha񯬃01vperohlatactrizveratlatmismatenalaszdos,vQuienaeratlatactrizv?v
[02:38] Libelula\SinRespeto 1 Pista: ****** ******* Valor pregunta : 21888 Puntos [02:38] Libelula\SinRespeto
1 Pista: ****** ******* Valor pregunta : 21888 Puntos
[02:38] Aguila}Insufrible jajajajaj mi ropa interior huele a chicharroncito [02:38] Aguila}Insufrible
jajajajaj mi ropa interior huele a chicharroncito
[02:38] Hipopotamo}Breve si esta carnudito [02:38] Hipopotamo}Breve
si esta carnudito
[02:38] Hipopotamo}Breve me encanta [02:38] Hipopotamo}Breve
me encanta
[02:39] EstrellaDeMar\Pedante Pura oreja y pellejo [02:39] EstrellaDeMar\Pedante
Pura oreja y pellejo
[02:39] EstrellaDeMar\Pedante xD [02:39] EstrellaDeMar\Pedante
xD
[02:39] Libelula\SinRespeto 2 Pista: ing*** ******* 30 segundos y 21888 Puntos [02:39] Libelula\SinRespeto
2 Pista: ing*** ******* 30 segundos y 21888 Puntos
[02:39] Hipopotamo}Breve que cochino eres xD [02:39] Hipopotamo}Breve
que cochino eres xD
[02:39] Libelula\SinRespeto 3 Pista: ing*i* *e***a* 15 segundos y 21888 Puntos [02:39] Libelula\SinRespeto
3 Pista: ing*i* *e***a* 15 segundos y 21888 Puntos
[02:39] Aguila}Insufrible y el cartilago cilindrico, EstrellaDeMar\Pedante no olvides ese [02:39] Aguila}Insufrible
y el cartilago cilindrico, EstrellaDeMar\Pedante no olvides ese
[02:39] Libelula\SinRespeto Tiempo! La respuesta es -> ingrid�ergman <- [02:39] Libelula\SinRespeto
Tiempo! La respuesta es -> ingrid�ergman <-
[02:39] EstrellaDeMar\Pedante [Aguila}Insufrible] No s鬠yo a�n no como ese. Te dir頣uando le de muela. [02:39] EstrellaDeMar\Pedante
[Aguila}Insufrible] No s鬠yo a�n no como ese. Te dir頣uando le de muela.
[02:39] EstrellaDeMar\Pedante xD [02:39] EstrellaDeMar\Pedante
xD
[02:39] Aguila}Insufrible el que parece bocinita bluetooth [02:39] Aguila}Insufrible
el que parece bocinita bluetooth
[02:39] Aguila}Insufrible jajajajajajajajajaj [02:39] Aguila}Insufrible
jajajajajajajajajaj
[02:39] Libelula\SinRespeto This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 552740 #19: karen-62 535210 #20: Carlos_55 468075 [02:39] Libelula\SinRespeto
This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 552740 #19: karen-62 535210 #20: Carlos_55 468075
[02:39] Libelula\SinRespeto Tri.4574 Informaticaɳtephenwo˿Conjuntoldevinstruccioneswquevsevrepitenrvariaswveceswseguidasw(informᴩca)?m?m [02:39] Libelula\SinRespeto
Tri.4574 Informaticaɳtephenwo˿Conjuntoldevinstruccioneswquevsevrepitenrvariaswveceswseguidasw(informᴩca)?m?m
[02:39] Libelula\SinRespeto 1 Pista: ***** Valor pregunta : 6704 Puntos [02:39] Libelula\SinRespeto
1 Pista: ***** Valor pregunta : 6704 Puntos
[02:39] Hipopotamo}Breve lo quieres morder [02:39] Hipopotamo}Breve
lo quieres morder
[02:39] Hipopotamo}Breve nuuuu [02:39] Hipopotamo}Breve
nuuuu
[02:39] Hipopotamo}Breve dizque duele [02:39] Hipopotamo}Breve
dizque duele
[02:39] EstrellaDeMar\Pedante Mr D, a�n estᠴiernito. xD [02:39] EstrellaDeMar\Pedante
Mr D, a�n estᠴiernito. xD
[02:40] Libelula\SinRespeto 2 Pista: buc** 30 segundos y 6704 Puntos [02:40] Libelula\SinRespeto
2 Pista: buc** 30 segundos y 6704 Puntos
[02:40] Aguila}Insufrible habra que morder [02:40] Aguila}Insufrible
habra que morder
[02:40] Aguila}Insufrible bucle [02:40] Aguila}Insufrible
bucle
[02:40] Libelula\SinRespeto �Increible!! Aguila}Insufrible contest󺠃04"bucle" en �2.344 segundos, y ha ganado �704�12 puntos [02:40] Libelula\SinRespeto
�Increible!! Aguila}Insufrible contest󺠃04"bucle" en �2.344 segundos, y ha ganado �704�12 puntos
[02:40] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:40] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:40] Libelula\SinRespeto Aguila}Insufrible has acertado 7 seguidas!! Puntos HOY: 431027, SEMANA: 18220026 y MES: 14548463 [02:40] Libelula\SinRespeto
Aguila}Insufrible has acertado 7 seguidas!! Puntos HOY: 431027, SEMANA: 18220026 y MES: 14548463
[02:40] Aguila}Insufrible Hipopotamo\Eficiente [02:40] Aguila}Insufrible
Hipopotamo\Eficiente
[02:40] EstrellaDeMar\Pedante Harᮠque me de hambre nuevamente [02:40] EstrellaDeMar\Pedante
Harᮠque me de hambre nuevamente
[02:40] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [02:40] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[02:40] Libelula\SinRespeto Tri.19680 InformaticaɆilipides˿23pdewdiciembrewdew1947.pLaboratoriosdBell,ptienewlugarllauinvenci󮃰1sdel...p?p [02:40] Libelula\SinRespeto
Tri.19680 InformaticaɆilipides˿23pdewdiciembrewdew1947.pLaboratoriosdBell,ptienewlugarllauinvenci󮃰1sdel...p?p
[02:40] Libelula\SinRespeto 1 Pista: ********** Valor pregunta : 22995 Puntos [02:40] Libelula\SinRespeto
1 Pista: ********** Valor pregunta : 22995 Puntos
[02:40] Hipopotamo}Breve dile a Mr D [02:40] Hipopotamo}Breve
dile a Mr D
[02:40] Libelula\SinRespeto 2 Pista: tra******* 30 segundos y 22995 Puntos [02:40] Libelula\SinRespeto
2 Pista: tra******* 30 segundos y 22995 Puntos
[02:40] Hipopotamo}Breve a ver si ofrece algo a que darle muela [02:40] Hipopotamo}Breve
a ver si ofrece algo a que darle muela
[02:40] Aguila}Insufrible traductor [02:40] Aguila}Insufrible
traductor
[02:40] EstrellaDeMar\Pedante ɬ feliz que lo mordisquee. xD [02:40] EstrellaDeMar\Pedante
ɬ feliz que lo mordisquee. xD
[02:40] Libelula\SinRespeto 3 Pista: tra**i**o* 15 segundos y 22995 Puntos [02:40] Libelula\SinRespeto
3 Pista: tra**i**o* 15 segundos y 22995 Puntos
[02:41] Aguila}Insufrible transistor [02:41] Aguila}Insufrible
transistor
[02:41] Libelula\SinRespeto �Absolutamente correcto Aguila}Insufrible!! Acertaste "transistor" en �8.546 segundos y ganas �2995�12 puntos [02:41] Libelula\SinRespeto
�Absolutamente correcto Aguila}Insufrible!! Acertaste "transistor" en �8.546 segundos y ganas �2995�12 puntos
[02:41] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:41] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:41] Libelula\SinRespeto Aguila}Insufrible has acertado 8 seguidas!! Puntos HOY: 454022, SEMANA: 18243021 y MES: 14571458 [02:41] Libelula\SinRespeto
Aguila}Insufrible has acertado 8 seguidas!! Puntos HOY: 454022, SEMANA: 18243021 y MES: 14571458
[02:41] Aguila}Insufrible y se pondra feliz si yo lo muerdo tambien? [02:41] Aguila}Insufrible
y se pondra feliz si yo lo muerdo tambien?
[02:41] Hipopotamo}Breve entre otras cosas xD [02:41] Hipopotamo}Breve
entre otras cosas xD
[02:41] Libelula\SinRespeto This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 581548 #15: Aguila-Especial 543035 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704 [02:41] Libelula\SinRespeto
This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 581548 #15: Aguila-Especial 543035 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704
[02:41] Libelula\SinRespeto Tri.10842 Medicina-Saludɬusie˅lscuerpodhumano:f߁rteriashquebaportanisangreboxigenadavavlashpiernas?f?f [02:41] Libelula\SinRespeto
Tri.10842 Medicina-Saludɬusie˅lscuerpodhumano:f߁rteriashquebaportanisangreboxigenadavavlashpiernas?f?f
[02:41] Libelula\SinRespeto 1 Pista: ******* Valor pregunta : 19981 Puntos [02:41] Libelula\SinRespeto
1 Pista: ******* Valor pregunta : 19981 Puntos
[02:41] Hipopotamo}Breve ya vas de ofrecidote [02:41] Hipopotamo}Breve
ya vas de ofrecidote
[02:41] Hipopotamo}Breve el Mr D aun enciende sus fantasias [02:41] Hipopotamo}Breve
el Mr D aun enciende sus fantasias
[02:41] EstrellaDeMar\Pedante Cre�ue ya se le hab�quitado la idea. xD [02:41] EstrellaDeMar\Pedante
Cre�ue ya se le hab�quitado la idea. xD
[02:41] Libelula\SinRespeto 2 Pista: ili**** 30 segundos y 19981 Puntos [02:41] Libelula\SinRespeto
2 Pista: ili**** 30 segundos y 19981 Puntos
[02:41] Aguila}Insufrible jajajajajajaja [02:41] Aguila}Insufrible
jajajajajajaja
[02:41] EstrellaDeMar\Pedante Se le hizo baba las patas. [02:41] EstrellaDeMar\Pedante
Se le hizo baba las patas.
[02:41] Libelula\SinRespeto 3 Pista: ilia*a* 15 segundos y 19981 Puntos [02:41] Libelula\SinRespeto
3 Pista: ilia*a* 15 segundos y 19981 Puntos
[02:41] Aguila}Insufrible tengo quijada de pitbull gordito [02:41] Aguila}Insufrible
tengo quijada de pitbull gordito
[02:42] Libelula\SinRespeto Tiempo! La respuesta es -> iliacas <- [02:42] Libelula\SinRespeto
Tiempo! La respuesta es -> iliacas <-
[02:42] Hipopotamo}Breve nada. el aun no ha olvidado a Mr D [02:42] Hipopotamo}Breve
nada. el aun no ha olvidado a Mr D
[02:42] Libelula\SinRespeto R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0 [02:42] Libelula\SinRespeto
R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0
[02:42] Libelula\SinRespeto Tri.10652 Cancionesɖonk˿Derquienlesdletqherdcryq?q [02:42] Libelula\SinRespeto
Tri.10652 Cancionesɖonk˿Derquienlesdletqherdcryq?q
[02:42] Libelula\SinRespeto 1 Pista: ****** *** *** ******** Valor pregunta : 9501 Puntos [02:42] Libelula\SinRespeto
1 Pista: ****** *** *** ******** Valor pregunta : 9501 Puntos
[02:42] Hipopotamo}Breve lo dejo alucinado [02:42] Hipopotamo}Breve
lo dejo alucinado
[02:42] Libelula\SinRespeto 2 Pista: hoo*** *** *** ******** 30 segundos y 9501 Puntos [02:42] Libelula\SinRespeto
2 Pista: hoo*** *** *** ******** 30 segundos y 9501 Puntos
[02:42] Aguila}Insufrible me dejo en silla de ruedas [02:42] Aguila}Insufrible
me dejo en silla de ruedas
[02:42] EstrellaDeMar\Pedante Ya veo, me lo quiere quitar. [02:42] EstrellaDeMar\Pedante
Ya veo, me lo quiere quitar.
[02:42] Aguila-Especial !tema [02:42] Aguila-Especial
!tema
[02:42] LeonConPereza Sonando: Madonna - Like a Prayer | Temática: Música Variada | Sintoniza: www.radiolunademiel.com [02:42] LeonConPereza
Sonando: Madonna - Like a Prayer | Temática: Música Variada | Sintoniza: www.radiolunademiel.com
[02:42] Aguila}Insufrible hootie and the blowfish [02:42] Aguila}Insufrible
hootie and the blowfish
[02:42] Libelula\SinRespeto �Muy bien Aguila}Insufrible!! Acertaste "hootie and the blowfish" en tan s󬯠�8.484 segundos y por eso has ganado: �501�12 puntos [02:42] Libelula\SinRespeto
�Muy bien Aguila}Insufrible!! Acertaste "hootie and the blowfish" en tan s󬯠�8.484 segundos y por eso has ganado: �501�12 puntos
[02:42] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:42] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:42] Libelula\SinRespeto Aguila}Insufrible has acertado 9 seguidas!! Puntos HOY: 463523, SEMANA: 18252522 y MES: 14580959 [02:42] Libelula\SinRespeto
Aguila}Insufrible has acertado 9 seguidas!! Puntos HOY: 463523, SEMANA: 18252522 y MES: 14580959
[02:42] Aguila-Especial !like [02:42] Aguila-Especial
!like
[02:42] LeonConPereza (👍Like) ¡Wow! por ese "me gusta" Tu apoyo Aguila-Especial significa mucho DJ: Caracol_ConPereza [02:42] LeonConPereza
(👍Like) ¡Wow! por ese "me gusta" Tu apoyo Aguila-Especial significa mucho DJ: Caracol_ConPereza
[02:42] EstrellaDeMar\Pedante [Aguila}Insufrible] Pero, tendr᳠que echarte escarcha para que brilles. xD [02:42] EstrellaDeMar\Pedante
[Aguila}Insufrible] Pero, tendr᳠que echarte escarcha para que brilles. xD
[02:43] Libelula\SinRespeto Top10 Players ( Weekly & Monthly ) are Auto-Voiced [02:43] Libelula\SinRespeto
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[02:43] Libelula\SinRespeto Tri.20809 Personajesɦlipp_er˿EniqueisiglofnaciofelufilosofofHume?o?o [02:43] Libelula\SinRespeto
Tri.20809 Personajesɦlipp_er˿EniqueisiglofnaciofelufilosofofHume?o?o
[02:43] Libelula\SinRespeto 1 Pista: ***** Valor pregunta : 9359 Puntos [02:43] Libelula\SinRespeto
1 Pista: ***** Valor pregunta : 9359 Puntos
[02:43] Libelula\SinRespeto 2 Pista: xvi** 30 segundos y 9359 Puntos [02:43] Libelula\SinRespeto
2 Pista: xvi** 30 segundos y 9359 Puntos
[02:43] Aguila}Insufrible echamelos pero que sea en la cara, elektra [02:43] Aguila}Insufrible
echamelos pero que sea en la cara, elektra
[02:43] Aguila}Insufrible Hipopotamo\Eficiente [02:43] Aguila}Insufrible
Hipopotamo\Eficiente
[02:43] Libelula\SinRespeto 3 Pista: xviii 15 segundos y 9359 Puntos [02:43] Libelula\SinRespeto
3 Pista: xviii 15 segundos y 9359 Puntos
[02:43] Hipopotamo}Breve jaaaaaaaaaaaaaaaaaaaaaaaa [02:43] Hipopotamo}Breve
jaaaaaaaaaaaaaaaaaaaaaaaa
[02:43] Hipopotamo}Breve te pasas xD [02:43] Hipopotamo}Breve
te pasas xD
[02:43] EstrellaDeMar\Pedante Ok, ya pongo a calentar agua. xD [02:43] EstrellaDeMar\Pedante
Ok, ya pongo a calentar agua. xD
[02:43] Aguila}Insufrible xviii [02:43] Aguila}Insufrible
xviii
[02:43] Libelula\SinRespeto �Eso es Aguila}Insufrible!! Dijiste: "xviii" y ello te ha valido: �359�12 puntos [02:43] Libelula\SinRespeto
�Eso es Aguila}Insufrible!! Dijiste: "xviii" y ello te ha valido: �359�12 puntos
[02:43] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:43] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:43] Libelula\SinRespeto Aguila}Insufrible has acertado 10 seguidas!! Puntos HOY: 472882, SEMANA: 18261881 y MES: 14590318 [02:43] Libelula\SinRespeto
Aguila}Insufrible has acertado 10 seguidas!! Puntos HOY: 472882, SEMANA: 18261881 y MES: 14590318
[02:43] Libelula\SinRespeto Bonus especial de 50000 Puntos para Aguila}Insufrible por acertar 10 seguidas!!! [02:43] Libelula\SinRespeto
Bonus especial de 50000 Puntos para Aguila}Insufrible por acertar 10 seguidas!!!
[02:43] Aguila}Insufrible jajajjajajajaja [02:43] Aguila}Insufrible
jajajjajajajaja
[02:43] ArdillaFeroz jaa [02:43] ArdillaFeroz
jaa
[02:44] EstrellaDeMar\Pedante [Aguila}Insufrible] A su merc鬠lo que pida. xD [02:44] EstrellaDeMar\Pedante
[Aguila}Insufrible] A su merc鬠lo que pida. xD
[02:44] Libelula\SinRespeto Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [02:44] Libelula\SinRespeto
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[02:44] Libelula\SinRespeto Tri.1383 Geografiaɴjmm.com˿ElcK2,jsegundaumonta񡃰1umasnaltaudelcmundo,jsesencuentrauenjlaucordillera...j?j [02:44] Libelula\SinRespeto
Tri.1383 Geografiaɴjmm.com˿ElcK2,jsegundaumonta񡃰1umasnaltaudelcmundo,jsesencuentrauenjlaucordillera...j?j
[02:44] Libelula\SinRespeto 1 Pista: ********* Pregunta de BONUS : 50000 Puntos [02:44] Libelula\SinRespeto
1 Pista: ********* Pregunta de BONUS : 50000 Puntos
[02:44] Hipopotamo\Eficiente Ehh [02:44] Hipopotamo\Eficiente
Ehh
[02:44] Hipopotamo\Eficiente ☺️ [02:44] Hipopotamo\Eficiente
☺️
[02:44] Libelula\SinRespeto 2 Pista: Kar****** 30 segundos y 50000 Puntos [02:44] Libelula\SinRespeto
2 Pista: Kar****** 30 segundos y 50000 Puntos
[02:44] Aguila}Insufrible mario kart [02:44] Aguila}Insufrible
mario kart
[02:44] Libelula\SinRespeto 3 Pista: Kara*o*u* 15 segundos y 50000 Puntos [02:44] Libelula\SinRespeto
3 Pista: Kara*o*u* 15 segundos y 50000 Puntos
[02:44] Hipopotamo\Eficiente Jajajaja [02:44] Hipopotamo\Eficiente
Jajajaja
[02:44] Hipopotamo\Eficiente Mams pescuezo [02:44] Hipopotamo\Eficiente
Mams pescuezo
[02:44] Aguila}Insufrible jajajajaj [02:44] Aguila}Insufrible
jajajajaj
[02:44] Libelula\SinRespeto Tiempo! La respuesta es -> Karakorum <- [02:44] Libelula\SinRespeto
Tiempo! La respuesta es -> Karakorum <-
[02:44] Aguila}Insufrible andas lamiendo esa madre? [02:44] Aguila}Insufrible
andas lamiendo esa madre?
[02:44] Hipopotamo\Eficiente No [02:44] Hipopotamo\Eficiente
No
[02:45] Aguila-Especial ArdillaFeroz saludos por aca [02:45] Aguila-Especial
ArdillaFeroz saludos por aca
[02:45] Libelula\SinRespeto R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 18311881 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 13978660 #5: Culebra}Agil 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3677435 [02:45] Libelula\SinRespeto
R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 18311881 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 13978660 #5: Culebra}Agil 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3677435
[02:45] Libelula\SinRespeto Tri.11356 Idiomasɳtephewo˿Gallegop-gcastellanop"gaiola"?g?g [02:45] Libelula\SinRespeto
Tri.11356 Idiomasɳtephewo˿Gallegop-gcastellanop"gaiola"?g?g
[02:45] Libelula\SinRespeto 1 Pista: ***** Valor pregunta : 17012 Puntos [02:45] Libelula\SinRespeto
1 Pista: ***** Valor pregunta : 17012 Puntos
[02:45] Aguila}Insufrible mira te presento a la elektra y a la Hipopotamo}Breve [02:45] Aguila}Insufrible
mira te presento a la elektra y a la Hipopotamo}Breve
[02:45] Aguila-Especial Hipopotamo\Eficiente nas noches [02:45] Aguila-Especial
Hipopotamo\Eficiente nas noches
[02:45] Aguila}Insufrible les gusta masticar [02:45] Aguila}Insufrible
les gusta masticar
[02:45] Aguila-Especial Cocodrilo-ConPrisa buenas cheeeee [02:45] Aguila-Especial
Cocodrilo-ConPrisa buenas cheeeee
[02:45] Hipopotamo}Breve no me presentes a nadie [02:45] Hipopotamo}Breve
no me presentes a nadie
[02:45] Libelula\SinRespeto 2 Pista: jau** 30 segundos y 17012 Puntos [02:45] Libelula\SinRespeto
2 Pista: jau** 30 segundos y 17012 Puntos
[02:45] Hipopotamo\Eficiente Aguila-Especial: holi nena [02:45] Hipopotamo\Eficiente
Aguila-Especial: holi nena
[02:45] Libelula\SinRespeto �Absolutamente correcto Aguila}Insufrible!! Acertaste "jaula" en �2.203 segundos y ganas �7012�12 puntos [02:45] Libelula\SinRespeto
�Absolutamente correcto Aguila}Insufrible!! Acertaste "jaula" en �2.203 segundos y ganas �7012�12 puntos
[02:45] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:45] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:45] Libelula\SinRespeto Aguila}Insufrible has acertado 11 seguidas!! Puntos HOY: 539894, SEMANA: 18328893 y MES: 14657330 [02:45] Libelula\SinRespeto
Aguila}Insufrible has acertado 11 seguidas!! Puntos HOY: 539894, SEMANA: 18328893 y MES: 14657330
[02:45] Aguila}Insufrible jaula [02:45] Aguila}Insufrible
jaula
[02:45] Hipopotamo\Eficiente Jajaja [02:45] Hipopotamo\Eficiente
Jajaja
[02:45] Aguila-Especial Jaula [02:45] Aguila-Especial
Jaula
[02:45] ArdillaFeroz [Aguila-Especial] saludos [02:45] ArdillaFeroz
[Aguila-Especial] saludos
[02:45] ArdillaFeroz al fin te haces ver [02:45] ArdillaFeroz
al fin te haces ver
[02:45] Aguila}Insufrible te la gan頫itana_- [02:45] Aguila}Insufrible
te la gan頫itana_-
[02:45] Hipopotamo\Eficiente Las cacatúas atacan de nuevo [02:45] Hipopotamo\Eficiente
Las cacatúas atacan de nuevo
[02:45] Libelula\SinRespeto We feature over 50,000 Q&A ! [02:45] Libelula\SinRespeto
We feature over 50,000 Q&A !
[02:45] Libelula\SinRespeto Tri.2169 Cineɬusie˨2004)uComojunaximagen.uDirigeqlaxactrizuytguionistaxfrancesaxߑui鮿u?u [02:45] Libelula\SinRespeto
Tri.2169 Cineɬusie˨2004)uComojunaximagen.uDirigeqlaxactrizuytguionistaxfrancesaxߑui鮿u?u
[02:45] Libelula\SinRespeto 1 Pista: ***** ***** Valor pregunta : 6827 Puntos [02:45] Libelula\SinRespeto
1 Pista: ***** ***** Valor pregunta : 6827 Puntos
[02:45] EstrellaDeMar\Pedante [Aguila}Insufrible] M᳠respetico... No sea igualado, atrevido. [02:45] EstrellaDeMar\Pedante
[Aguila}Insufrible] M᳠respetico... No sea igualado, atrevido.
[02:45] Hipopotamo\Eficiente 🤣🤣🤣 [02:45] Hipopotamo\Eficiente
🤣🤣🤣
[02:45] Aguila}Insufrible mirame Aguila-Especial bendito entre todas las mujeres [02:45] Aguila}Insufrible
mirame Aguila-Especial bendito entre todas las mujeres
[02:45] Libelula\SinRespeto 2 Pista: agn** ***** 30 segundos y 6827 Puntos [02:45] Libelula\SinRespeto
2 Pista: agn** ***** 30 segundos y 6827 Puntos
[02:45] Aguila}Insufrible jajajajjaajjajajajajaja [02:45] Aguila}Insufrible
jajajajjaajjajajajajaja
[02:45] Hipopotamo}Breve me habia olvidado de nuestro titulo xD [02:45] Hipopotamo}Breve
me habia olvidado de nuestro titulo xD
[02:46] Aguila-Especial Welcome3 wow impresionada [02:46] Aguila-Especial
Welcome3 wow impresionada
[02:46] Aguila-Especial 0.o [02:46] Aguila-Especial
0.o
[02:46] Libelula\SinRespeto 3 Pista: agne* *aoui 15 segundos y 6827 Puntos [02:46] Libelula\SinRespeto
3 Pista: agne* *aoui 15 segundos y 6827 Puntos
[02:46] Hipopotamo\Eficiente 😜 [02:46] Hipopotamo\Eficiente
😜
[02:46] Aguila-Especial !tema [02:46] Aguila-Especial
!tema
[02:46] Libelula\SinRespeto Tiempo! La respuesta es -> agnes�aoui <- [02:46] Libelula\SinRespeto
Tiempo! La respuesta es -> agnes�aoui <-
[02:46] LeonConPereza Emitiendo ( Caracol_ConPereza ) | Lugar ( PuertoRico ) | Temática ( Música Variada ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Pide tu canción comando: !tocame Tema-Artista [02:46] LeonConPereza
Emitiendo ( Caracol_ConPereza ) | Lugar ( PuertoRico ) | Temática ( Música Variada ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Pide tu canción comando: !tocame Tema-Artista
[02:46] EstrellaDeMar\Pedante [Aguila}Insufrible] Claro, si ya quieres ser una de nosotras. Hasta mi novio quieres mordisquear. xD [02:46] EstrellaDeMar\Pedante
[Aguila}Insufrible] Claro, si ya quieres ser una de nosotras. Hasta mi novio quieres mordisquear. xD
[02:46] Aguila}Insufrible est᳠emitiendo Aguila-Especial? [02:46] Aguila}Insufrible
est᳠emitiendo Aguila-Especial?
[02:46] Hipopotamo}Breve xD [02:46] Hipopotamo}Breve
xD
[02:46] LeonConPereza Sonando: Maria Daines - Goodbye | Temática: Música Variada | Sintoniza: www.radiolunademiel.com [02:46] LeonConPereza
Sonando: Maria Daines - Goodbye | Temática: Música Variada | Sintoniza: www.radiolunademiel.com
[02:46] Libelula\SinRespeto Tri.3414 Geografiaɓebosin˿Endqu郰1wprovinciabsexhallabSiero?w?w [02:46] Libelula\SinRespeto
Tri.3414 Geografiaɓebosin˿Endqu郰1wprovinciabsexhallabSiero?w?w
[02:46] Libelula\SinRespeto 1 Pista: ******** Valor pregunta : 8086 Puntos [02:46] Libelula\SinRespeto
1 Pista: ******** Valor pregunta : 8086 Puntos
[02:46] Aguila-Especial Welcome3 no emite Caracol_ConPereza [02:46] Aguila-Especial
Welcome3 no emite Caracol_ConPereza
[02:46] Libelula\SinRespeto 2 Pista: ast***** 30 segundos y 8086 Puntos [02:46] Libelula\SinRespeto
2 Pista: ast***** 30 segundos y 8086 Puntos
[02:46] Aguila-Especial Asturias [02:46] Aguila-Especial
Asturias
[02:46] Libelula\SinRespeto �As�e hace Aguila-Especial!! Contestaste "Asturias" en �0.203 segundos y sumas �086�12 puntos [02:46] Libelula\SinRespeto
�As�e hace Aguila-Especial!! Contestaste "Asturias" en �0.203 segundos y sumas �086�12 puntos
[02:46] Libelula\SinRespeto Aguila-Especial has acertado 1 seguidas!! Puntos HOY: 8086, SEMANA: 560826 y MES: 551121 [02:46] Libelula\SinRespeto
Aguila-Especial has acertado 1 seguidas!! Puntos HOY: 8086, SEMANA: 560826 y MES: 551121
[02:46] Aguila}Insufrible asturias [02:46] Aguila}Insufrible
asturias
[02:47] EstrellaDeMar\Pedante La gente es muy igualada, yo que t�, le doy sus latigazos al [Aguila}Insufrible] por atrevido. [02:47] EstrellaDeMar\Pedante
La gente es muy igualada, yo que t�, le doy sus latigazos al [Aguila}Insufrible] por atrevido.
[02:47] Libelula\SinRespeto Tri.8235 Informaticaɴjmm.com˅ntlagcajagdelyordenador,relyparfdeccablecillosa(verdecymblancododnegro)rquecvantdelyfrontalyaglagplacagbaseccorrespondecalyledmde...r?r [02:47] Libelula\SinRespeto
Tri.8235 Informaticaɴjmm.com˅ntlagcajagdelyordenador,relyparfdeccablecillosa(verdecymblancododnegro)rquecvantdelyfrontalyaglagplacagbaseccorrespondecalyledmde...r?r
[02:47] Libelula\SinRespeto 1 Pista: ********* Valor pregunta : 18087 Puntos [02:47] Libelula\SinRespeto
1 Pista: ********* Valor pregunta : 18087 Puntos
[02:47] Libelula\SinRespeto 2 Pista: enc****** 30 segundos y 18087 Puntos [02:47] Libelula\SinRespeto
2 Pista: enc****** 30 segundos y 18087 Puntos
[02:47] Aguila}Insufrible encendido [02:47] Aguila}Insufrible
encendido
[02:47] Libelula\SinRespeto �Increible!! Aguila}Insufrible contest󺠃04"encendido" en �4.032 segundos, y ha ganado �8087�12 puntos [02:47] Libelula\SinRespeto
�Increible!! Aguila}Insufrible contest󺠃04"encendido" en �4.032 segundos, y ha ganado �8087�12 puntos
[02:47] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:47] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:47] Libelula\SinRespeto Aguila}Insufrible has acertado 1 seguidas!! Puntos HOY: 557981, SEMANA: 18346980 y MES: 14675417 [02:47] Libelula\SinRespeto
Aguila}Insufrible has acertado 1 seguidas!! Puntos HOY: 557981, SEMANA: 18346980 y MES: 14675417
[02:47] Hipopotamo}Breve nuuu [02:47] Hipopotamo}Breve
nuuu
[02:47] Hipopotamo}Breve eso le gusta [02:47] Hipopotamo}Breve
eso le gusta
[02:47] EstrellaDeMar\Pedante Por eso anda ama񡤯, xD [02:47] EstrellaDeMar\Pedante
Por eso anda ama񡤯, xD
[02:47] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [02:47] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[02:47] Libelula\SinRespeto Tri.19480 Medicina-Saludɍonteso˿Elbbociohlohproducejlaqhipertrofiaqdejquejglandulaq?s [02:47] Libelula\SinRespeto
Tri.19480 Medicina-Saludɍonteso˿Elbbociohlohproducejlaqhipertrofiaqdejquejglandulaq?s
[02:47] Libelula\SinRespeto 1 Pista: ******** Valor pregunta : 7366 Puntos [02:47] Libelula\SinRespeto
1 Pista: ******** Valor pregunta : 7366 Puntos
[02:47] Hipopotamo}Breve sip xD [02:47] Hipopotamo}Breve
sip xD
[02:48] Libelula\SinRespeto 2 Pista: tir***** 30 segundos y 7366 Puntos [02:48] Libelula\SinRespeto
2 Pista: tir***** 30 segundos y 7366 Puntos
[02:48] Libelula\SinRespeto �emuestra lo que sabes Aguila}Insufrible! Has respondido "tiroides" correctamente y eso te da: �366�12 puntos [02:48] Libelula\SinRespeto
�emuestra lo que sabes Aguila}Insufrible! Has respondido "tiroides" correctamente y eso te da: �366�12 puntos
[02:48] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:48] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:48] Libelula\SinRespeto Aguila}Insufrible has acertado 2 seguidas!! Puntos HOY: 565347, SEMANA: 18354346 y MES: 14682783 [02:48] Libelula\SinRespeto
Aguila}Insufrible has acertado 2 seguidas!! Puntos HOY: 565347, SEMANA: 18354346 y MES: 14682783
[02:48] Aguila}Insufrible tiroides [02:48] Aguila}Insufrible
tiroides
[02:48] Aguila-Especial !tema [02:48] Aguila-Especial
!tema
[02:48] LeonConPereza Sonando: Maria Daines - Goodbye | Temática: Música Variada | Sintoniza: www.radiolunademiel.com [02:48] LeonConPereza
Sonando: Maria Daines - Goodbye | Temática: Música Variada | Sintoniza: www.radiolunademiel.com
[02:48] Aguila-Especial Yaaaaa [02:48] Aguila-Especial
Yaaaaa
[02:48] Aguila-Especial XD [02:48] Aguila-Especial
XD
[02:48] Libelula\SinRespeto R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0 [02:48] Libelula\SinRespeto
R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0
[02:48] Libelula\SinRespeto Tri.17522 Personajesɳubmarin˿AlmirantetbritᮩcofquetpermitiofaoInglaterraolograrielsdominiofdetloskmareskeneelssiglofXVIIw?w [02:48] Libelula\SinRespeto
Tri.17522 Personajesɳubmarin˿AlmirantetbritᮩcofquetpermitiofaoInglaterraolograrielsdominiofdetloskmareskeneelssiglofXVIIw?w
[02:48] Libelula\SinRespeto 1 Pista: ****** ***** Valor pregunta : 15188 Puntos [02:48] Libelula\SinRespeto
1 Pista: ****** ***** Valor pregunta : 15188 Puntos
[02:48] Libelula\SinRespeto 2 Pista: rob*** ***** 30 segundos y 15188 Puntos [02:48] Libelula\SinRespeto
2 Pista: rob*** ***** 30 segundos y 15188 Puntos
[02:48] Aguila}Insufrible qu頬e quieres modificar , Aguila-Especial? [02:48] Aguila}Insufrible
qu頬e quieres modificar , Aguila-Especial?
[02:49] Libelula\SinRespeto 3 Pista: robe** **a*e 15 segundos y 15188 Puntos [02:49] Libelula\SinRespeto
3 Pista: robe** **a*e 15 segundos y 15188 Puntos
[02:49] Libelula\SinRespeto Tiempo! La respuesta es -> robert�lake <- [02:49] Libelula\SinRespeto
Tiempo! La respuesta es -> robert�lake <-
[02:49] Libelula\SinRespeto If you think a Q&A is wrong, please call an OP [02:49] Libelula\SinRespeto
If you think a Q&A is wrong, please call an OP
[02:49] Libelula\SinRespeto Tri.3226 Mitologiaɴjmm.com˿HijazdehMinospyrPasifae.vLehdioqazTeseoqellhiloqquehlehpermiti󃰱vsalirwdelllaberintoqdellMinotauroq?v [02:49] Libelula\SinRespeto
Tri.3226 Mitologiaɴjmm.com˿HijazdehMinospyrPasifae.vLehdioqazTeseoqellhiloqquehlehpermiti󃰱vsalirwdelllaberintoqdellMinotauroq?v
[02:49] Libelula\SinRespeto 1 Pista: ******* Valor pregunta : 17213 Puntos [02:49] Libelula\SinRespeto
1 Pista: ******* Valor pregunta : 17213 Puntos
[02:49] Libelula\SinRespeto 2 Pista: ari**** 30 segundos y 17213 Puntos [02:49] Libelula\SinRespeto
2 Pista: ari**** 30 segundos y 17213 Puntos
[02:50] Libelula\SinRespeto 3 Pista: aria**a 15 segundos y 17213 Puntos [02:50] Libelula\SinRespeto
3 Pista: aria**a 15 segundos y 17213 Puntos
[02:50] Aguila}Insufrible arianna [02:50] Aguila}Insufrible
arianna
[02:50] Aguila}Insufrible ariadna [02:50] Aguila}Insufrible
ariadna
[02:50] Libelula\SinRespeto �Bien Aguila}Insufrible!! Tu respuesta: "ariadna" es correcta y ganas �7213�12 puntos [02:50] Libelula\SinRespeto
�Bien Aguila}Insufrible!! Tu respuesta: "ariadna" es correcta y ganas �7213�12 puntos
[02:50] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:50] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:50] Libelula\SinRespeto Aguila}Insufrible has acertado 3 seguidas!! Puntos HOY: 582560, SEMANA: 18371559 y MES: 14699996 [02:50] Libelula\SinRespeto
Aguila}Insufrible has acertado 3 seguidas!! Puntos HOY: 582560, SEMANA: 18371559 y MES: 14699996
[02:50] Libelula\SinRespeto R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0 [02:50] Libelula\SinRespeto
R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0
[02:50] Libelula\SinRespeto Tri.10712 Idiomasɲaziel9˿FRANCES--->ESPA񏌺oeufcdury?n [02:50] Libelula\SinRespeto
Tri.10712 Idiomasɲaziel9˿FRANCES--->ESPA񏌺oeufcdury?n
[02:50] Libelula\SinRespeto 1 Pista: ***** **** Valor pregunta : 8380 Puntos [02:50] Libelula\SinRespeto
1 Pista: ***** **** Valor pregunta : 8380 Puntos
[02:50] Aguila-Especial Welcome3 no no solo verificaba algo todo fino [02:50] Aguila-Especial
Welcome3 no no solo verificaba algo todo fino
[02:50] Libelula\SinRespeto 2 Pista: hue** **** 30 segundos y 8380 Puntos [02:50] Libelula\SinRespeto
2 Pista: hue** **** 30 segundos y 8380 Puntos
[02:50] Libelula\SinRespeto 3 Pista: hue*o *u*o 15 segundos y 8380 Puntos [02:50] Libelula\SinRespeto
3 Pista: hue*o *u*o 15 segundos y 8380 Puntos
[02:51] Libelula\SinRespeto Tiempo! La respuesta es -> huevo�uro <- [02:51] Libelula\SinRespeto
Tiempo! La respuesta es -> huevo�uro <-
[02:51] Aguila-Especial Huevo duro [02:51] Aguila-Especial
Huevo duro
[02:51] Libelula\SinRespeto For The Competitive Edge type !pingme [02:51] Libelula\SinRespeto
For The Competitive Edge type !pingme
[02:51] Libelula\SinRespeto Tri.16062 CancionesɃocoman˿Deequienvesflaicancionv"Lailluviainuncaivuelveehaciaiarriba"u?u [02:51] Libelula\SinRespeto
Tri.16062 CancionesɃocoman˿Deequienvesflaicancionv"Lailluviainuncaivuelveehaciaiarriba"u?u
[02:51] Libelula\SinRespeto 1 Pista: ***** ****** Pregunta de BONUS : 100000 Puntos [02:51] Libelula\SinRespeto
1 Pista: ***** ****** Pregunta de BONUS : 100000 Puntos
[02:51] Aguila}Insufrible jajajaj [02:51] Aguila}Insufrible
jajajaj
[02:51] Aguila}Insufrible porque me dices as�? [02:51] Aguila}Insufrible
porque me dices as�?
[02:51] Aguila}Insufrible Aguila-Especial [02:51] Aguila}Insufrible
Aguila-Especial
[02:51] Libelula\SinRespeto 2 Pista: ped** ****** 30 segundos y 100000 Puntos [02:51] Libelula\SinRespeto
2 Pista: ped** ****** 30 segundos y 100000 Puntos
[02:51] Aguila-Especial ^^ [02:51] Aguila-Especial
^^
[02:51] Libelula\SinRespeto 3 Pista: ped*o *ue**a 15 segundos y 100000 Puntos [02:51] Libelula\SinRespeto
3 Pista: ped*o *ue**a 15 segundos y 100000 Puntos
[02:51] Aguila-Especial No te dije nada chamo [02:51] Aguila-Especial
No te dije nada chamo
[02:51] Hipopotamo\Eficiente Que tú huevo está duro [02:51] Hipopotamo\Eficiente
Que tú huevo está duro
[02:51] Hipopotamo\Eficiente Jajajaja [02:51] Hipopotamo\Eficiente
Jajajaja
[02:51] Aguila}Insufrible <@Aguila-Especial> Huevo duro [02:51] Aguila}Insufrible
<@Aguila-Especial> Huevo duro
[02:52] Libelula\SinRespeto Tiempo! La respuesta es -> pedro�uerra <- [02:52] Libelula\SinRespeto
Tiempo! La respuesta es -> pedro�uerra <-
[02:52] Aguila}Insufrible jajajajajaja [02:52] Aguila}Insufrible
jajajajajaja
[02:52] Aguila-Especial Hablo del huevo para ensalada no te lances Aguila}Insufrible [02:52] Aguila-Especial
Hablo del huevo para ensalada no te lances Aguila}Insufrible
[02:52] Libelula\SinRespeto Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [02:52] Libelula\SinRespeto
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[02:52] Libelula\SinRespeto Tri.14889 GeografiaɍARdeJAVA˿CU�cEScLAcCIUDADcM�cPOBLADAcDEcCHIPRE,cCONc200.000cHABITANTES?c?c [02:52] Libelula\SinRespeto
Tri.14889 GeografiaɍARdeJAVA˿CU�cEScLAcCIUDADcM�cPOBLADAcDEcCHIPRE,cCONc200.000cHABITANTES?c?c
[02:52] Libelula\SinRespeto 1 Pista: ******* Valor pregunta : 18823 Puntos [02:52] Libelula\SinRespeto
1 Pista: ******* Valor pregunta : 18823 Puntos
[02:52] Hipopotamo\Eficiente Jajajaja [02:52] Hipopotamo\Eficiente
Jajajaja
[02:52] Aguila}Insufrible ahhhh jajajajaja [02:52] Aguila}Insufrible
ahhhh jajajajaja
[02:52] Hipopotamo\Eficiente Está rico [02:52] Hipopotamo\Eficiente
Está rico
[02:52] Hipopotamo\Eficiente Con atún [02:52] Hipopotamo\Eficiente
Con atún
[02:52] Hipopotamo\Eficiente 🤣 [02:52] Hipopotamo\Eficiente
🤣
[02:52] Libelula\SinRespeto 2 Pista: nic**** 30 segundos y 18823 Puntos [02:52] Libelula\SinRespeto
2 Pista: nic**** 30 segundos y 18823 Puntos
[02:52] ArdillaFeroz y ensalada [02:52] ArdillaFeroz
y ensalada
[02:52] ArdillaFeroz ja [02:52] ArdillaFeroz
ja
[02:52] ArdillaFeroz hola Hipopotamo\Eficiente [02:52] ArdillaFeroz
hola Hipopotamo\Eficiente
[02:52] Libelula\SinRespeto 3 Pista: nico*ia 15 segundos y 18823 Puntos [02:52] Libelula\SinRespeto
3 Pista: nico*ia 15 segundos y 18823 Puntos
[02:52] Hipopotamo\Eficiente Nicotina [02:52] Hipopotamo\Eficiente
Nicotina
[02:52] Aguila}Insufrible nicoria [02:52] Aguila}Insufrible
nicoria
[02:52] Aguila}Insufrible nicolia [02:52] Aguila}Insufrible
nicolia
[02:52] Aguila}Insufrible niconia [02:52] Aguila}Insufrible
niconia
[02:53] Hipopotamo\Eficiente ArdillaFeroz: holi [02:53] Hipopotamo\Eficiente
ArdillaFeroz: holi
[02:53] Libelula\SinRespeto Tiempo! La respuesta es -> nicosia <- [02:53] Libelula\SinRespeto
Tiempo! La respuesta es -> nicosia <-
[02:53] Libelula\SinRespeto R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 14699996 #4: Cocodrilo-ConPrisa 13978660 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3677435 #9: LaCamelia 3029384 #10: Karen 1224969 [02:53] Libelula\SinRespeto
R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 14699996 #4: Cocodrilo-ConPrisa 13978660 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3677435 #9: LaCamelia 3029384 #10: Karen 1224969
[02:53] Libelula\SinRespeto Tri.4950 Historiaɭartuniki˿LAhGRANhENCICLOPEDIAhDEhLAShCIENCIAShMeDICAShYhNATURALEShDELhMEDIOEVOh?h [02:53] Libelula\SinRespeto
Tri.4950 Historiaɭartuniki˿LAhGRANhENCICLOPEDIAhDEhLAShCIENCIAShMeDICAShYhNATURALEShDELhMEDIOEVOh?h
[02:53] Libelula\SinRespeto 1 Pista: ***** ********* ** ******* Valor pregunta : 11805 Puntos [02:53] Libelula\SinRespeto
1 Pista: ***** ********* ** ******* Valor pregunta : 11805 Puntos
[02:53] EstrellaDeMar\Pedante [Hipopotamo}Breve] Estan que me pierden. xD [02:53] EstrellaDeMar\Pedante
[Hipopotamo}Breve] Estan que me pierden. xD
[02:53] Aguila-Especial Hipopotamo\Eficiente asi es y lechuga le pones yogur en vez de mahonesa [02:53] Aguila-Especial
Hipopotamo\Eficiente asi es y lechuga le pones yogur en vez de mahonesa
[02:53] Libelula\SinRespeto 2 Pista: can** ********* ** ******* 30 segundos y 11805 Puntos [02:53] Libelula\SinRespeto
2 Pista: can** ********* ** ******* 30 segundos y 11805 Puntos
[02:53] Aguila}Insufrible cuenten recetas para engordar [02:53] Aguila}Insufrible
cuenten recetas para engordar
[02:53] Hipopotamo}Breve [EstrellaDeMar\Pedante] quien? [02:53] Hipopotamo}Breve
[EstrellaDeMar\Pedante] quien?
[02:53] Libelula\SinRespeto 3 Pista: cano* *e*i*i*ae *e a*i*e*a 15 segundos y 11805 Puntos [02:53] Libelula\SinRespeto
3 Pista: cano* *e*i*i*ae *e a*i*e*a 15 segundos y 11805 Puntos
[02:53] Aguila}Insufrible necesito ponerme bien gordito [02:53] Aguila}Insufrible
necesito ponerme bien gordito
[02:53] EstrellaDeMar\Pedante Pues, adivina. [02:53] EstrellaDeMar\Pedante
Pues, adivina.
[02:53] ArdillaFeroz yogur? [02:53] ArdillaFeroz
yogur?
[02:54] Hipopotamo\Eficiente Aguila-Especial: que rico [02:54] Hipopotamo\Eficiente
Aguila-Especial: que rico
[02:54] Libelula\SinRespeto Tiempo! La respuesta es -> canon�edicinae�e�vicena <- [02:54] Libelula\SinRespeto
Tiempo! La respuesta es -> canon�edicinae�e�vicena <-
[02:54] Hipopotamo\Eficiente Aguila}Insufrible: más? [02:54] Hipopotamo\Eficiente
Aguila}Insufrible: más?
[02:54] Aguila}Insufrible jajaajaj estoy en mis costillas [02:54] Aguila}Insufrible
jajaajaj estoy en mis costillas
[02:54] Libelula\SinRespeto Please refrain from using Extreme Bad Language [02:54] Libelula\SinRespeto
Please refrain from using Extreme Bad Language
[02:54] EstrellaDeMar\Pedante Primero hab�un beb頱ue no me dejaba chatear, ya lo entregu頡 su madre. Y ahora, lleg󠬯 m� xD [02:54] EstrellaDeMar\Pedante
Primero hab�un beb頱ue no me dejaba chatear, ya lo entregu頡 su madre. Y ahora, lleg󠬯 m� xD
[02:54] Libelula\SinRespeto Tri.11238 CancionesɃarPEnTer˿C󭯃01msedllamafelncow-boywdedunafdedlasmcancionesmdedJuampafywsuyGuitarraf?y [02:54] Libelula\SinRespeto
Tri.11238 CancionesɃarPEnTer˿C󭯃01msedllamafelncow-boywdedunafdedlasmcancionesmdedJuampafywsuyGuitarraf?y
[02:54] Libelula\SinRespeto 1 Pista: **** ** **** Pregunta de BONUS : 50000 Puntos [02:54] Libelula\SinRespeto
1 Pista: **** ** **** Pregunta de BONUS : 50000 Puntos
[02:54] Hipopotamo\Eficiente Jajajaja jajajaja jajajaja jajajaja jajajaja [02:54] Hipopotamo\Eficiente
Jajajaja jajajaja jajajaja jajajaja jajajaja
[02:54] Hipopotamo}Breve jaaaaaaaaaaaaaaaaaaaaaaaaaaaaa [02:54] Hipopotamo}Breve
jaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
[02:54] Hipopotamo\Eficiente Alvrg [02:54] Hipopotamo\Eficiente
Alvrg
[02:54] Libelula\SinRespeto 2 Pista: jac* ** **** 30 segundos y 50000 Puntos [02:54] Libelula\SinRespeto
2 Pista: jac* ** **** 30 segundos y 50000 Puntos
[02:54] Aguila}Insufrible te embarazaron elektra? [02:54] Aguila}Insufrible
te embarazaron elektra?
[02:54] Hipopotamo}Breve odio al Mr D [02:54] Hipopotamo}Breve
odio al Mr D
[02:54] Aguila}Insufrible es bueno el embarazamiento [02:54] Aguila}Insufrible
es bueno el embarazamiento
[02:54] Aguila}Insufrible navide�o [02:54] Aguila}Insufrible
navide�o
[02:54] Libelula\SinRespeto 3 Pista: jac* e* *e*e 15 segundos y 50000 Puntos [02:54] Libelula\SinRespeto
3 Pista: jac* e* *e*e 15 segundos y 50000 Puntos
[02:54] EstrellaDeMar\Pedante [Aguila}Insufrible] Ya quisieran pero no. xD [02:54] EstrellaDeMar\Pedante
[Aguila}Insufrible] Ya quisieran pero no. xD
[02:55] Libelula\SinRespeto Tiempo! La respuesta es -> jack�l�ene <- [02:55] Libelula\SinRespeto
Tiempo! La respuesta es -> jack�l�ene <-
[02:55] Aguila}Insufrible jajajja [02:55] Aguila}Insufrible
jajajja
[02:55] EstrellaDeMar\Pedante [Aguila}Insufrible] embarazate t�, yo estoy bien as�omo estoy. [02:55] EstrellaDeMar\Pedante
[Aguila}Insufrible] embarazate t�, yo estoy bien as�omo estoy.
[02:55] EstrellaDeMar\Pedante xD [02:55] EstrellaDeMar\Pedante
xD
[02:55] Libelula\SinRespeto This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto [02:55] Libelula\SinRespeto
This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto
[02:55] Libelula\SinRespeto Tri.14882 CineɍARdeJAVA˿CONhQUɃ01hNOMBREhEShM�hCONOCIDOhELhACTORhNICHOLAShKIMhCOPPOLAh?h?h [02:55] Libelula\SinRespeto
Tri.14882 CineɍARdeJAVA˿CONhQUɃ01hNOMBREhEShM�hCONOCIDOhELhACTORhNICHOLAShKIMhCOPPOLAh?h?h
[02:55] Libelula\SinRespeto 1 Pista: ******* **** Pregunta de BONUS : 50000 Puntos [02:55] Libelula\SinRespeto
1 Pista: ******* **** Pregunta de BONUS : 50000 Puntos
[02:55] Aguila}Insufrible jajajajajajaj embarazame [02:55] Aguila}Insufrible
jajajajajajaj embarazame
[02:55] Aguila-Especial ArdillaFeroz usa el yogur para ensaladas es deli [02:55] Aguila-Especial
ArdillaFeroz usa el yogur para ensaladas es deli
[02:55] EstrellaDeMar\Pedante [Hipopotamo}Breve] Te entiendo, yo tambi鮠lo odio a ratos. xD [02:55] EstrellaDeMar\Pedante
[Hipopotamo}Breve] Te entiendo, yo tambi鮠lo odio a ratos. xD
[02:55] Libelula\SinRespeto 2 Pista: nic**** **** 30 segundos y 50000 Puntos [02:55] Libelula\SinRespeto
2 Pista: nic**** **** 30 segundos y 50000 Puntos
[02:55] Hipopotamo}Breve juasssssssssssssssssssss [02:55] Hipopotamo}Breve
juasssssssssssssssssssss
[02:55] Aguila-Especial !tema [02:55] Aguila-Especial
!tema
[02:55] LeonConPereza Sonando: Madonna - Like a Virgin | Temática: Música Variada | Sintoniza: www.radiolunademiel.com [02:55] LeonConPereza
Sonando: Madonna - Like a Virgin | Temática: Música Variada | Sintoniza: www.radiolunademiel.com
[02:55] Aguila-Especial !like [02:55] Aguila-Especial
!like
[02:55] Aguila}Insufrible nicolas cage [02:55] Aguila}Insufrible
nicolas cage
[02:55] Libelula\SinRespeto �Eso es Aguila}Insufrible!! Dijiste: "nicolas cage" y ello te ha valido: �0000�12 puntos [02:55] Libelula\SinRespeto
�Eso es Aguila}Insufrible!! Dijiste: "nicolas cage" y ello te ha valido: �0000�12 puntos
[02:55] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:55] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:55] Libelula\SinRespeto Aguila}Insufrible has acertado 4 seguidas!! Puntos HOY: 632560, SEMANA: 18421559 y MES: 14749996 [02:55] Libelula\SinRespeto
Aguila}Insufrible has acertado 4 seguidas!! Puntos HOY: 632560, SEMANA: 18421559 y MES: 14749996
[02:55] LeonConPereza (👍Like) ¡Genial! Gracias por tu 👍 Me Gusta A DJ: Caracol_ConPereza [02:55] LeonConPereza
(👍Like) ¡Genial! Gracias por tu 👍 Me Gusta A DJ: Caracol_ConPereza
[02:55] Libelula\SinRespeto This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 560826 #19: karen-62 535210 #20: Carlos_55 468075 [02:55] Libelula\SinRespeto
This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 560826 #19: karen-62 535210 #20: Carlos_55 468075
[02:55] Libelula\SinRespeto Tri.20973 Biologiaɪcrazy_Sp˿JeangBaptistekdekLamarckbpropusowunaxexplicaci󮃰1gcinetificaxsobreklaxevolucion,qperowaxquekramaxdeklaxcienciaxsekdedicabaxexactamentek?q [02:55] Libelula\SinRespeto
Tri.20973 Biologiaɪcrazy_Sp˿JeangBaptistekdekLamarckbpropusowunaxexplicaci󮃰1gcinetificaxsobreklaxevolucion,qperowaxquekramaxdeklaxcienciaxsekdedicabaxexactamentek?q
[02:55] Libelula\SinRespeto 1 Pista: ******** Valor pregunta : 18263 Puntos [02:55] Libelula\SinRespeto
1 Pista: ******** Valor pregunta : 18263 Puntos
[02:55] Aguila-Especial ArdillaFeroz emite Caracol_ConPereza te invito a oirlo si te apetece [02:55] Aguila-Especial
ArdillaFeroz emite Caracol_ConPereza te invito a oirlo si te apetece
[02:56] Libelula\SinRespeto 2 Pista: zoo***** 30 segundos y 18263 Puntos [02:56] Libelula\SinRespeto
2 Pista: zoo***** 30 segundos y 18263 Puntos
[02:56] Aguila}Insufrible zoologia [02:56] Aguila}Insufrible
zoologia
[02:56] Libelula\SinRespeto �Muy bien Aguila}Insufrible!! Acertaste "zoologia" en tan s󬯠�5.641 segundos y por eso has ganado: �8263�12 puntos [02:56] Libelula\SinRespeto
�Muy bien Aguila}Insufrible!! Acertaste "zoologia" en tan s󬯠�5.641 segundos y por eso has ganado: �8263�12 puntos
[02:56] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [02:56] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[02:56] Libelula\SinRespeto Aguila}Insufrible has acertado 5 seguidas!! Puntos HOY: 650823, SEMANA: 18439822 y MES: 14768259 [02:56] Libelula\SinRespeto
Aguila}Insufrible has acertado 5 seguidas!! Puntos HOY: 650823, SEMANA: 18439822 y MES: 14768259
[02:56] ArdillaFeroz gracias kitana_ [02:56] ArdillaFeroz
gracias kitana_
[02:56] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [02:56] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[02:56] Libelula\SinRespeto Tri.4557 Arteɤassler˿Aaqui鮃01osecdebeclaac�pulaadecSantaaMar�01adeclasmFlores,a(catedraljdecFlorencia)?a?a [02:56] Libelula\SinRespeto
Tri.4557 Arteɤassler˿Aaqui鮃01osecdebeclaac�pulaadecSantaaMar�01adeclasmFlores,a(catedraljdecFlorencia)?a?a
[02:56] Libelula\SinRespeto 1 Pista: ************ Pregunta de BONUS : 100000 Puntos [02:56] Libelula\SinRespeto
1 Pista: ************ Pregunta de BONUS : 100000 Puntos
[02:56] ArdillaFeroz luego puess [02:56] ArdillaFeroz
luego puess
[02:56] Aguila-Especial Chevere ArdillaFeroz [02:56] Aguila-Especial
Chevere ArdillaFeroz
[02:56] Libelula\SinRespeto 2 Pista: bru********* 30 segundos y 100000 Puntos [02:56] Libelula\SinRespeto
2 Pista: bru********* 30 segundos y 100000 Puntos
[02:57] Libelula\SinRespeto 3 Pista: bru*e**e***i 15 segundos y 100000 Puntos [02:57] Libelula\SinRespeto
3 Pista: bru*e**e***i 15 segundos y 100000 Puntos
[02:57] Aguila}Insufrible quieroooo encontrar motivos para enamorarme empiricamenteeee [02:57] Aguila}Insufrible
quieroooo encontrar motivos para enamorarme empiricamenteeee
[02:57] Libelula\SinRespeto Tiempo! La respuesta es -> brunelleschi <- [02:57] Libelula\SinRespeto
Tiempo! La respuesta es -> brunelleschi <-
[02:57] Libelula\SinRespeto This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 581548 #15: Aguila-Especial 551121 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704 [02:57] Libelula\SinRespeto
This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 581548 #15: Aguila-Especial 551121 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704
[02:57] Libelula\SinRespeto Tri.15390 Historiaɳherif˿Comoesendenominaronplosdcincoesectoresdenplosdquenprodujoeelkdesembarcoedennormandia?t?t [02:57] Libelula\SinRespeto
Tri.15390 Historiaɳherif˿Comoesendenominaronplosdcincoesectoresdenplosdquenprodujoeelkdesembarcoedennormandia?t?t
[02:57] Libelula\SinRespeto 1 Pista: ***** **** **** **** * ***** Valor pregunta : 19014 Puntos [02:57] Libelula\SinRespeto
1 Pista: ***** **** **** **** * ***** Valor pregunta : 19014 Puntos
[02:57] EstrellaDeMar\Pedante [Aguila}Insufrible] Por eso entras al chat, xD [02:57] EstrellaDeMar\Pedante
[Aguila}Insufrible] Por eso entras al chat, xD
[02:57] Aguila}Insufrible vivaaaa la poesiaaa del amor certerooooo destinadooooo a la satisfacci󮠭atrimonial [02:57] Aguila}Insufrible
vivaaaa la poesiaaa del amor certerooooo destinadooooo a la satisfacci󮠭atrimonial
[02:57] ArdillaFeroz [Aguila-Especial] emitir᳠luego? [02:57] ArdillaFeroz
[Aguila-Especial] emitir᳠luego?
[02:57] Libelula\SinRespeto 2 Pista: oma** **** **** **** * ***** 30 segundos y 19014 Puntos [02:57] Libelula\SinRespeto
2 Pista: oma** **** **** **** * ***** 30 segundos y 19014 Puntos
[02:57] Aguila-Especial !tocame chistiam nodal-ame [02:57] Aguila-Especial
!tocame chistiam nodal-ame
[02:57] LeonConPereza Tema Aceptado con exito Aguila-Especial en un momento mas la escucharas[215] [02:57] LeonConPereza
Tema Aceptado con exito Aguila-Especial en un momento mas la escucharas[215]
[02:57] Aguila}Insufrible nooo nodal nooooo [02:57] Aguila}Insufrible
nooo nodal nooooo
[02:57] Libelula\SinRespeto 3 Pista: oma*a u*a* *o** *u*o * **o** 15 segundos y 19014 Puntos [02:57] Libelula\SinRespeto
3 Pista: oma*a u*a* *o** *u*o * **o** 15 segundos y 19014 Puntos
[02:58] Aguila-Especial ArdillaFeroz posiblemente si no me caigo xD [02:58] Aguila-Especial
ArdillaFeroz posiblemente si no me caigo xD
[02:58] Aguila}Insufrible jajajajajaj elektra [02:58] Aguila}Insufrible
jajajajajaj elektra
[02:58] Libelula\SinRespeto Tiempo! La respuesta es -> omaha�tah�old�uno��word <- [02:58] Libelula\SinRespeto
Tiempo! La respuesta es -> omaha�tah�old�uno��word <-
[02:58] Aguila}Insufrible para enamorarme? [02:58] Aguila}Insufrible
para enamorarme?
[02:58] EstrellaDeMar\Pedante Por ah�ebe haber un tutorias sobre enamoramientos chateales, [Aguila}Insufrible] [02:58] EstrellaDeMar\Pedante
Por ah�ebe haber un tutorias sobre enamoramientos chateales, [Aguila}Insufrible]
[02:58] Hipopotamo}Breve van a poner musica del nopal? [02:58] Hipopotamo}Breve
van a poner musica del nopal?
[02:58] Libelula\SinRespeto R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0 [02:58] Libelula\SinRespeto
R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0
[02:58] Libelula\SinRespeto Tri.5376 Musicaɫainn˿Comoksigueblasfrase:m"CentralqRock,m..."m?m [02:58] Libelula\SinRespeto
Tri.5376 Musicaɫainn˿Comoksigueblasfrase:m"CentralqRock,m..."m?m
[02:58] Libelula\SinRespeto 1 Pista: ******* *** ****** Valor pregunta : 16862 Puntos [02:58] Libelula\SinRespeto
1 Pista: ******* *** ****** Valor pregunta : 16862 Puntos
[02:58] Hipopotamo}Breve que feos gustos, eh [02:58] Hipopotamo}Breve
que feos gustos, eh
[02:58] Aguila-Especial Noooooo manches raios [02:58] Aguila-Especial
Noooooo manches raios
[02:58] Libelula\SinRespeto 2 Pista: cen**** *** ****** 30 segundos y 16862 Puntos [02:58] Libelula\SinRespeto
2 Pista: cen**** *** ****** 30 segundos y 16862 Puntos
[02:58] EstrellaDeMar\Pedante [Hipopotamo}Breve] ߨab� cambiado los gustos? [02:58] EstrellaDeMar\Pedante
[Hipopotamo}Breve] ߨab� cambiado los gustos?
[02:59] Libelula\SinRespeto 3 Pista: cen**a* *e* *o*i*o 15 segundos y 16862 Puntos [02:59] Libelula\SinRespeto
3 Pista: cen**a* *e* *o*i*o 15 segundos y 16862 Puntos
[02:59] Libelula\SinRespeto Tiempo! La respuesta es -> central�el�onido <- [02:59] Libelula\SinRespeto
Tiempo! La respuesta es -> central�el�onido <-
[02:59] Hipopotamo}Breve la verdad, a veces son peores [02:59] Hipopotamo}Breve
la verdad, a veces son peores
[02:59] Libelula\SinRespeto Top10 Players ( Weekly & Monthly ) are Auto-Voiced [02:59] Libelula\SinRespeto
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[02:59] Libelula\SinRespeto Tri.17711 CineɎordik˿C󭯃01qseqllamaqelj�ltimoqreplicanteqenu"BladeqRunneru?z [02:59] Libelula\SinRespeto
Tri.17711 CineɎordik˿C󭯃01qseqllamaqelj�ltimoqreplicanteqenu"BladeqRunneru?z
[02:59] Libelula\SinRespeto 1 Pista: *** ***** Valor pregunta : 7230 Puntos [02:59] Libelula\SinRespeto
1 Pista: *** ***** Valor pregunta : 7230 Puntos
[02:59] Libelula\SinRespeto 2 Pista: roy ***** 30 segundos y 7230 Puntos [02:59] Libelula\SinRespeto
2 Pista: roy ***** 30 segundos y 7230 Puntos
[03:00] Libelula\SinRespeto 3 Pista: roy *a*** 15 segundos y 7230 Puntos [03:00] Libelula\SinRespeto
3 Pista: roy *a*** 15 segundos y 7230 Puntos
[03:00] EstrellaDeMar\Pedante O sea, normal. xD [03:00] EstrellaDeMar\Pedante
O sea, normal. xD
[03:00] Libelula\SinRespeto Tiempo! La respuesta es -> roy�atty <- [03:00] Libelula\SinRespeto
Tiempo! La respuesta es -> roy�atty <-
[03:00] Aguila}Insufrible si quieren cantar aqui les presto el microfono [03:00] Aguila}Insufrible
si quieren cantar aqui les presto el microfono
[03:00] Aguila}Insufrible tiene funda de piel [03:00] Aguila}Insufrible
tiene funda de piel
[03:00] Libelula\SinRespeto Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [03:00] Libelula\SinRespeto
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[03:00] Libelula\SinRespeto Tri.19462 Personajesɴamzarian˿Fot󧲡fadykrevolucionariadnacidadenrItalia.tParticip󃰱tenrladguerradcivilpespa񯬡djuntocadsudesposo,tVittoriocVidalik?t [03:00] Libelula\SinRespeto
Tri.19462 Personajesɴamzarian˿Fot󧲡fadykrevolucionariadnacidadenrItalia.tParticip󃰱tenrladguerradcivilpespa񯬡djuntocadsudesposo,tVittoriocVidalik?t
[03:00] Libelula\SinRespeto 1 Pista: **** ******* Valor pregunta : 19924 Puntos [03:00] Libelula\SinRespeto
1 Pista: **** ******* Valor pregunta : 19924 Puntos
[03:00] Libelula\SinRespeto 2 Pista: tin* ******* 30 segundos y 19924 Puntos [03:00] Libelula\SinRespeto
2 Pista: tin* ******* 30 segundos y 19924 Puntos
[03:00] EstrellaDeMar\Pedante Mira, ofreciendo esas porquer�, l饴e cien a񯳠de seriedad, [Aguila}Insufrible] [03:00] EstrellaDeMar\Pedante
Mira, ofreciendo esas porquer�, l饴e cien a񯳠de seriedad, [Aguila}Insufrible]
[03:01] Libelula\SinRespeto 3 Pista: tina *o*o**i 15 segundos y 19924 Puntos [03:01] Libelula\SinRespeto
3 Pista: tina *o*o**i 15 segundos y 19924 Puntos
[03:01] Hipopotamo}Breve nah, yo tengo voz fea [03:01] Hipopotamo}Breve
nah, yo tengo voz fea
[03:01] Hipopotamo}Breve [EstrellaDeMar\Pedante] jajajajajajajajaaaaaaaaaaaaaaaaaaaa [03:01] Hipopotamo}Breve
[EstrellaDeMar\Pedante] jajajajajajajajaaaaaaaaaaaaaaaaaaaa
[03:01] Libelula\SinRespeto Tiempo! La respuesta es -> tina�odotti <- [03:01] Libelula\SinRespeto
Tiempo! La respuesta es -> tina�odotti <-
[03:01] Libelula\SinRespeto R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 18439822 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 13978660 #5: Culebra}Agil 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3677435 [03:01] Libelula\SinRespeto
R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 18439822 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 13978660 #5: Culebra}Agil 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3677435
[03:01] Libelula\SinRespeto Tri.2537 Geografiaɓebosin˿Enwqu郰1rprovinciajestჰ1relqmunicipiondejAspe?r?r [03:01] Libelula\SinRespeto
Tri.2537 Geografiaɓebosin˿Enwqu郰1rprovinciajestჰ1relqmunicipiondejAspe?r?r
[03:01] Libelula\SinRespeto 1 Pista: ******** Valor pregunta : 7833 Puntos [03:01] Libelula\SinRespeto
1 Pista: ******** Valor pregunta : 7833 Puntos
[03:01] Aguila}Insufrible elektra te tocara cantar a tiiiiii!!!! te pondr頶aselina [03:01] Aguila}Insufrible
elektra te tocara cantar a tiiiiii!!!! te pondr頶aselina
[03:01] Aguila}Insufrible en la garganta [03:01] Aguila}Insufrible
en la garganta
[03:01] Libelula\SinRespeto 2 Pista: ali***** 30 segundos y 7833 Puntos [03:01] Libelula\SinRespeto
2 Pista: ali***** 30 segundos y 7833 Puntos
[03:01] Aguila}Insufrible alicante [03:01] Aguila}Insufrible
alicante
[03:01] Libelula\SinRespeto �Bingo!! Aguila}Insufrible dio la respuesta: "alicante" en �8.718 segundos e incrementa sus ganancias con �833�12 puntos [03:01] Libelula\SinRespeto
�Bingo!! Aguila}Insufrible dio la respuesta: "alicante" en �8.718 segundos e incrementa sus ganancias con �833�12 puntos
[03:01] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [03:01] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[03:01] Libelula\SinRespeto Aguila}Insufrible has acertado 6 seguidas!! Puntos HOY: 658656, SEMANA: 18447655 y MES: 14776092 [03:01] Libelula\SinRespeto
Aguila}Insufrible has acertado 6 seguidas!! Puntos HOY: 658656, SEMANA: 18447655 y MES: 14776092
[03:01] EstrellaDeMar\Pedante [Aguila}Insufrible] Vos como que no quieres llegar a los 90 a񯳮 [03:01] EstrellaDeMar\Pedante
[Aguila}Insufrible] Vos como que no quieres llegar a los 90 a񯳮
[03:02] Libelula\SinRespeto We feature over 50,000 Q&A ! [03:02] Libelula\SinRespeto
We feature over 50,000 Q&A !
[03:02] Libelula\SinRespeto Tri.4753 Historiaɳtephenwo˿Cuᬃ01cfueblac�nicacposesi󮃰1jinglesacenjFranciacdespu鳃01ideblacguerracdeblosicienja񯳿c?c [03:02] Libelula\SinRespeto
Tri.4753 Historiaɳtephenwo˿Cuᬃ01cfueblac�nicacposesi󮃰1jinglesacenjFranciacdespu鳃01ideblacguerracdeblosicienja񯳿c?c
[03:02] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 21981 Puntos [03:02] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 21981 Puntos
[03:02] EstrellaDeMar\Pedante No le busques males al cuerpo. [03:02] EstrellaDeMar\Pedante
No le busques males al cuerpo.
[03:02] Aguila}Insufrible jajjajajajajaja [03:02] Aguila}Insufrible
jajjajajajajaja
[03:02] Libelula\SinRespeto 2 Pista: cal*** 30 segundos y 21981 Puntos [03:02] Libelula\SinRespeto
2 Pista: cal*** 30 segundos y 21981 Puntos
[03:02] Hipopotamo}Breve jaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa [03:02] Hipopotamo}Breve
jaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
[03:02] Libelula\SinRespeto 3 Pista: calai* 15 segundos y 21981 Puntos [03:02] Libelula\SinRespeto
3 Pista: calai* 15 segundos y 21981 Puntos
[03:02] Libelula\SinRespeto �Enhorabuena Aguila}Insufrible!! Has contestado "calais" y por ello has ganado �1981�12 puntos [03:02] Libelula\SinRespeto
�Enhorabuena Aguila}Insufrible!! Has contestado "calais" y por ello has ganado �1981�12 puntos
[03:02] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [03:02] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[03:02] Libelula\SinRespeto Aguila}Insufrible has acertado 7 seguidas!! Puntos HOY: 680637, SEMANA: 18469636 y MES: 14798073 [03:02] Libelula\SinRespeto
Aguila}Insufrible has acertado 7 seguidas!! Puntos HOY: 680637, SEMANA: 18469636 y MES: 14798073
[03:02] Aguila}Insufrible calais [03:02] Aguila}Insufrible
calais
[03:02] Libelula\SinRespeto Tri.20248 CancionesɐEDROC˿ESTEhTIOhCANTABAhENTREhOTRASh"GLORIA"h"BROWNEDhEYEDhGIRL"hYhEShIRLANDES"h?h [03:02] Libelula\SinRespeto
Tri.20248 CancionesɐEDROC˿ESTEhTIOhCANTABAhENTREhOTRASh"GLORIA"h"BROWNEDhEYEDhGIRL"hYhEShIRLANDES"h?h
[03:02] Libelula\SinRespeto 1 Pista: *** ******** Pregunta de BONUS : 50000 Puntos [03:02] Libelula\SinRespeto
1 Pista: *** ******** Pregunta de BONUS : 50000 Puntos
[03:03] Libelula\SinRespeto 2 Pista: van ******** 30 segundos y 50000 Puntos [03:03] Libelula\SinRespeto
2 Pista: van ******** 30 segundos y 50000 Puntos
[03:03] Aguila}Insufrible van morrisey [03:03] Aguila}Insufrible
van morrisey
[03:03] Libelula\SinRespeto �Absolutamente correcto Aguila}Insufrible!! Acertaste "van morrison" en �8.172 segundos y ganas �0000�12 puntos [03:03] Libelula\SinRespeto
�Absolutamente correcto Aguila}Insufrible!! Acertaste "van morrison" en �8.172 segundos y ganas �0000�12 puntos
[03:03] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [03:03] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[03:03] Libelula\SinRespeto Aguila}Insufrible has acertado 8 seguidas!! Puntos HOY: 730637, SEMANA: 18519636 y MES: 14848073 [03:03] Libelula\SinRespeto
Aguila}Insufrible has acertado 8 seguidas!! Puntos HOY: 730637, SEMANA: 18519636 y MES: 14848073
[03:03] Aguila}Insufrible van morrison [03:03] Aguila}Insufrible
van morrison
[03:03] Libelula\SinRespeto Tri.19 Cienciaɍorse˿C󤩧owMorse:vletraeEv?v [03:03] Libelula\SinRespeto
Tri.19 Cienciaɍorse˿C󤩧owMorse:vletraeEv?v
[03:03] Libelula\SinRespeto 1 Pista: . Valor pregunta : 8852 Puntos [03:03] Libelula\SinRespeto
1 Pista: . Valor pregunta : 8852 Puntos
[03:03] Libelula\SinRespeto �e nota que sabes mucho de esto Aguila}Insufrible! Tu respuesta "." es correcta y ganas �852�12 puntos [03:03] Libelula\SinRespeto
�e nota que sabes mucho de esto Aguila}Insufrible! Tu respuesta "." es correcta y ganas �852�12 puntos
[03:03] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [03:03] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[03:03] Libelula\SinRespeto Aguila}Insufrible has acertado 9 seguidas!! Puntos HOY: 739489, SEMANA: 18528488 y MES: 14856925 [03:03] Libelula\SinRespeto
Aguila}Insufrible has acertado 9 seguidas!! Puntos HOY: 739489, SEMANA: 18528488 y MES: 14856925
[03:03] Aguila}Insufrible . [03:03] Aguila}Insufrible
.
[03:04] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [03:04] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[03:04] Libelula\SinRespeto Tri.11733 ArteɄUBLINERS˿ElnEscorialnselbasolenmlosiplanosiylproyectosidelJuanmBautistaodelToledolyl....??d?d [03:04] Libelula\SinRespeto
Tri.11733 ArteɄUBLINERS˿ElnEscorialnselbasolenmlosiplanosiylproyectosidelJuanmBautistaodelToledolyl....??d?d
[03:04] Libelula\SinRespeto 1 Pista: **** ** ******* Valor pregunta : 9864 Puntos [03:04] Libelula\SinRespeto
1 Pista: **** ** ******* Valor pregunta : 9864 Puntos
[03:04] Libelula\SinRespeto 2 Pista: jua* ** ******* 30 segundos y 9864 Puntos [03:04] Libelula\SinRespeto
2 Pista: jua* ** ******* 30 segundos y 9864 Puntos
[03:04] Aguila-Especial !like [03:04] Aguila-Especial
!like
[03:04] LeonConPereza (👍Like) ¡Genial! Gracias por tu 👍 Me Gusta A DJ: Caracol_ConPereza [03:04] LeonConPereza
(👍Like) ¡Genial! Gracias por tu 👍 Me Gusta A DJ: Caracol_ConPereza
[03:04] Aguila}Insufrible quiero enamorar con el pie izquierdo [03:04] Aguila}Insufrible
quiero enamorar con el pie izquierdo
[03:04] Libelula\SinRespeto 3 Pista: jua* *e *e**e*a 15 segundos y 9864 Puntos [03:04] Libelula\SinRespeto
3 Pista: jua* *e *e**e*a 15 segundos y 9864 Puntos
[03:04] Libelula\SinRespeto Tiempo! La respuesta es -> juan�e�errera <- [03:04] Libelula\SinRespeto
Tiempo! La respuesta es -> juan�e�errera <-
[03:05] Aguila}Insufrible tirar besos blancos, besos rojos, besos negros [03:05] Aguila}Insufrible
tirar besos blancos, besos rojos, besos negros
[03:05] Libelula\SinRespeto R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0 [03:05] Libelula\SinRespeto
R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0
[03:05] Libelula\SinRespeto Tri.15300 Personajesɬusie˅nu1990msetletconcedi󃰱meloPremiorNobelodetLiteratura.mPoemasd(1979)mya�bolodetadentror(1987).mߑui鮿m?m [03:05] Libelula\SinRespeto
Tri.15300 Personajesɬusie˅nu1990msetletconcedi󃰱meloPremiorNobelodetLiteratura.mPoemasd(1979)mya�bolodetadentror(1987).mߑui鮿m?m
[03:05] Libelula\SinRespeto 1 Pista: ******* *** Valor pregunta : 19288 Puntos [03:05] Libelula\SinRespeto
1 Pista: ******* *** Valor pregunta : 19288 Puntos
[03:05] EstrellaDeMar\Pedante [Hipopotamo}Breve] ߱u頬e hiciste hoy al [Aguila}Insufrible] ? [03:05] EstrellaDeMar\Pedante
[Hipopotamo}Breve] ߱u頬e hiciste hoy al [Aguila}Insufrible] ?
[03:05] Aguila}Insufrible octavio paz [03:05] Aguila}Insufrible
octavio paz
[03:05] Libelula\SinRespeto �Bien Aguila}Insufrible!! Tu respuesta: "octavio paz" es correcta y ganas �9288�12 puntos [03:05] Libelula\SinRespeto
�Bien Aguila}Insufrible!! Tu respuesta: "octavio paz" es correcta y ganas �9288�12 puntos
[03:05] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [03:05] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[03:05] Libelula\SinRespeto Aguila}Insufrible has acertado 10 seguidas!! Puntos HOY: 758777, SEMANA: 18547776 y MES: 14876213 [03:05] Libelula\SinRespeto
Aguila}Insufrible has acertado 10 seguidas!! Puntos HOY: 758777, SEMANA: 18547776 y MES: 14876213
[03:05] Libelula\SinRespeto Bonus especial de 50000 Puntos para Aguila}Insufrible por acertar 10 seguidas!!! [03:05] Libelula\SinRespeto
Bonus especial de 50000 Puntos para Aguila}Insufrible por acertar 10 seguidas!!!
[03:05] Hipopotamo}Breve yo nada. asi es siempre [03:05] Hipopotamo}Breve
yo nada. asi es siempre
[03:05] Libelula\SinRespeto If you think a Q&A is wrong, please call an OP [03:05] Libelula\SinRespeto
If you think a Q&A is wrong, please call an OP
[03:05] Libelula\SinRespeto Tri.13159 InformaticaɖaKaMiLKa˿Cualveskelvnavegadorkendmodobtextobm᳃01kfamosobparayLinuxc?c [03:05] Libelula\SinRespeto
Tri.13159 InformaticaɖaKaMiLKa˿Cualveskelvnavegadorkendmodobtextobm᳃01kfamosobparayLinuxc?c
[03:05] Libelula\SinRespeto 1 Pista: **** Pregunta de BONUS : 25000 Puntos [03:05] Libelula\SinRespeto
1 Pista: **** Pregunta de BONUS : 25000 Puntos
[03:05] Hipopotamo}Breve xD [03:05] Hipopotamo}Breve
xD
[03:05] Libelula\SinRespeto 2 Pista: lyn* 30 segundos y 25000 Puntos [03:05] Libelula\SinRespeto
2 Pista: lyn* 30 segundos y 25000 Puntos
[03:05] EstrellaDeMar\Pedante Pero se lo diste en cantidades alarmantes. xD [03:05] EstrellaDeMar\Pedante
Pero se lo diste en cantidades alarmantes. xD
[03:05] Aguila}Insufrible lynx [03:05] Aguila}Insufrible
lynx
[03:05] Libelula\SinRespeto �Absolutamente correcto Aguila}Insufrible!! Acertaste "lynx" en �9.688 segundos y ganas �5000�12 puntos [03:05] Libelula\SinRespeto
�Absolutamente correcto Aguila}Insufrible!! Acertaste "lynx" en �9.688 segundos y ganas �5000�12 puntos
[03:05] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [03:05] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[03:05] Libelula\SinRespeto Aguila}Insufrible has acertado 11 seguidas!! Puntos HOY: 833777, SEMANA: 18622776 y MES: 14951213 [03:05] Libelula\SinRespeto
Aguila}Insufrible has acertado 11 seguidas!! Puntos HOY: 833777, SEMANA: 18622776 y MES: 14951213
[03:06] Libelula\SinRespeto R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0 [03:06] Libelula\SinRespeto
R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0
[03:06] Libelula\SinRespeto Tri.2060 Arteɬusie˿C󭯃01rserllamapeltpretiltormureterquerserhacersobrerlapcornisapderunwedificiorparapocultarkelttejado?a?a [03:06] Libelula\SinRespeto
Tri.2060 Arteɬusie˿C󭯃01rserllamapeltpretiltormureterquerserhacersobrerlapcornisapderunwedificiorparapocultarkelttejado?a?a
[03:06] Libelula\SinRespeto 1 Pista: ********* Valor pregunta : 23434 Puntos [03:06] Libelula\SinRespeto
1 Pista: ********* Valor pregunta : 23434 Puntos
[03:06] Aguila}Insufrible me tieeeenee flaccooooooo [03:06] Aguila}Insufrible
me tieeeenee flaccooooooo
[03:06] Hipopotamo}Breve hoy vino intenso [03:06] Hipopotamo}Breve
hoy vino intenso
[03:06] LeonConPereza Emitiendo ( Caracol_ConPereza ) | Lugar ( PuertoRico ) | Temática ( Música Variada ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Pide tu canción comando: !tocame Tema-Artista [03:06] LeonConPereza
Emitiendo ( Caracol_ConPereza ) | Lugar ( PuertoRico ) | Temática ( Música Variada ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Pide tu canción comando: !tocame Tema-Artista
[03:06] EstrellaDeMar\Pedante �ucristo! [03:06] EstrellaDeMar\Pedante
�ucristo!
[03:06] Libelula\SinRespeto 2 Pista: acr****** 30 segundos y 23434 Puntos [03:06] Libelula\SinRespeto
2 Pista: acr****** 30 segundos y 23434 Puntos
[03:06] Hipopotamo}Breve a mi no me culpes de tu perdida de peso [03:06] Hipopotamo}Breve
a mi no me culpes de tu perdida de peso
[03:06] Aguila}Insufrible la trivia me pone bien cachondo [03:06] Aguila}Insufrible
la trivia me pone bien cachondo
[03:06] EstrellaDeMar\Pedante Estoy que le doy su cascarazo [03:06] EstrellaDeMar\Pedante
Estoy que le doy su cascarazo
[03:06] Hipopotamo}Breve eres tu quien no tiene llenadera [03:06] Hipopotamo}Breve
eres tu quien no tiene llenadera
[03:06] Libelula\SinRespeto 3 Pista: acro*e*io 15 segundos y 23434 Puntos [03:06] Libelula\SinRespeto
3 Pista: acro*e*io 15 segundos y 23434 Puntos
[03:06] Hipopotamo}Breve xD [03:06] Hipopotamo}Breve
xD
[03:06] EstrellaDeMar\Pedante Jajajajajajajajaja [03:06] EstrellaDeMar\Pedante
Jajajajajajajajaja
[03:06] Libelula\SinRespeto Tiempo! La respuesta es -> acroterio <- [03:06] Libelula\SinRespeto
Tiempo! La respuesta es -> acroterio <-
[03:06] Hipopotamo}Breve [EstrellaDeMar\Pedante] no le des. a el le gusta la mala vida [03:06] Hipopotamo}Breve
[EstrellaDeMar\Pedante] no le des. a el le gusta la mala vida
[03:07] Libelula\SinRespeto For The Competitive Edge type !pingme [03:07] Libelula\SinRespeto
For The Competitive Edge type !pingme
[03:07] Libelula\SinRespeto Tri.2000 Economiaɤassler˿C󭯃01fserllamaulauAcci󮃰1kquerencuentraufᣩlmentercompradores?v?v [03:07] Libelula\SinRespeto
Tri.2000 Economiaɤassler˿C󭯃01fserllamaulauAcci󮃰1kquerencuentraufᣩlmentercompradores?v?v
[03:07] Libelula\SinRespeto 1 Pista: ****** ******* Valor pregunta : 9680 Puntos [03:07] Libelula\SinRespeto
1 Pista: ****** ******* Valor pregunta : 9680 Puntos
[03:07] Aguila}Insufrible mira ella tambien quiere [03:07] Aguila}Insufrible
mira ella tambien quiere
[03:07] Libelula\SinRespeto 2 Pista: acc*** ******* 30 segundos y 9680 Puntos [03:07] Libelula\SinRespeto
2 Pista: acc*** ******* 30 segundos y 9680 Puntos
[03:07] Aguila}Insufrible quiere andar como yo, destilando amor, Hipopotamo}Breve [03:07] Aguila}Insufrible
quiere andar como yo, destilando amor, Hipopotamo}Breve
[03:07] Hipopotamo}Breve quien ella? [03:07] Hipopotamo}Breve
quien ella?
[03:07] EstrellaDeMar\Pedante Despu鳠le queda gustando, yo a�n no tengo centro geriᴲico. [03:07] EstrellaDeMar\Pedante
Despu鳠le queda gustando, yo a�n no tengo centro geriᴲico.
[03:07] Aguila}Insufrible la elektra [03:07] Aguila}Insufrible
la elektra
[03:07] EstrellaDeMar\Pedante xD [03:07] EstrellaDeMar\Pedante
xD
[03:07] Libelula\SinRespeto 3 Pista: accio* *i*ui*a 15 segundos y 9680 Puntos [03:07] Libelula\SinRespeto
3 Pista: accio* *i*ui*a 15 segundos y 9680 Puntos
[03:07] Hipopotamo}Breve mi mujersh ya destila amorsh y es todo para mi [03:07] Hipopotamo}Breve
mi mujersh ya destila amorsh y es todo para mi
[03:07] Aguila}Insufrible accion liquida [03:07] Aguila}Insufrible
accion liquida
[03:07] Libelula\SinRespeto �e nota que sabes mucho de esto Aguila}Insufrible! Tu respuesta "accion liquida" es correcta y ganas �680�12 puntos [03:07] Libelula\SinRespeto
�e nota que sabes mucho de esto Aguila}Insufrible! Tu respuesta "accion liquida" es correcta y ganas �680�12 puntos
[03:07] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [03:07] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[03:07] Libelula\SinRespeto Aguila}Insufrible has acertado 12 seguidas!! Puntos HOY: 843457, SEMANA: 18632456 y MES: 14960893 [03:07] Libelula\SinRespeto
Aguila}Insufrible has acertado 12 seguidas!! Puntos HOY: 843457, SEMANA: 18632456 y MES: 14960893
[03:07] Hipopotamo}Breve bueno, no [03:07] Hipopotamo}Breve
bueno, no
[03:08] Hipopotamo}Breve un poquito para Mr D [03:08] Hipopotamo}Breve
un poquito para Mr D
[03:08] EstrellaDeMar\Pedante xD [03:08] EstrellaDeMar\Pedante
xD
[03:08] Libelula\SinRespeto Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [03:08] Libelula\SinRespeto
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[03:08] Libelula\SinRespeto Tri.16188 MitologiaɺAnn˿HijapdecD魥ter......c?c [03:08] Libelula\SinRespeto
Tri.16188 MitologiaɺAnn˿HijapdecD魥ter......c?c
[03:08] Libelula\SinRespeto 1 Pista: ********* Valor pregunta : 20252 Puntos [03:08] Libelula\SinRespeto
1 Pista: ********* Valor pregunta : 20252 Puntos
[03:08] Aguila}Insufrible trae la llavecita del amor destilado un poquito abierta [03:08] Aguila}Insufrible
trae la llavecita del amor destilado un poquito abierta
[03:08] Aguila}Insufrible porque anda chorreando [03:08] Aguila}Insufrible
porque anda chorreando
[03:08] Libelula\SinRespeto 2 Pista: per****** 30 segundos y 20252 Puntos [03:08] Libelula\SinRespeto
2 Pista: per****** 30 segundos y 20252 Puntos
[03:08] Hipopotamo}Breve jaaaaaaaaaaaaaaaaaaa [03:08] Hipopotamo}Breve
jaaaaaaaaaaaaaaaaaaa
[03:08] Aguila}Insufrible persefone [03:08] Aguila}Insufrible
persefone
[03:08] Libelula\SinRespeto �emuestra lo que sabes Aguila}Insufrible! Has respondido "persefone" correctamente y eso te da: �0252�12 puntos [03:08] Libelula\SinRespeto
�emuestra lo que sabes Aguila}Insufrible! Has respondido "persefone" correctamente y eso te da: �0252�12 puntos
[03:08] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [03:08] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[03:08] Libelula\SinRespeto Aguila}Insufrible has acertado 13 seguidas!! Puntos HOY: 863709, SEMANA: 18652708 y MES: 14981145 [03:08] Libelula\SinRespeto
Aguila}Insufrible has acertado 13 seguidas!! Puntos HOY: 863709, SEMANA: 18652708 y MES: 14981145
[03:08] EstrellaDeMar\Pedante [Aguila}Insufrible] traigo el oasis que todos quieren. [03:08] EstrellaDeMar\Pedante
[Aguila}Insufrible] traigo el oasis que todos quieren.
[03:08] EstrellaDeMar\Pedante xD [03:08] EstrellaDeMar\Pedante
xD
[03:08] Hipopotamo}Breve te va a dar con el bate xD [03:08] Hipopotamo}Breve
te va a dar con el bate xD
[03:08] Aguila}Insufrible jajajajajajajajajajaja [03:08] Aguila}Insufrible
jajajajajajajajajajaja
[03:08] Libelula\SinRespeto R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 14960893 #4: Cocodrilo-ConPrisa 13978660 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3677435 #9: LaCamelia 3029384 #10: Karen 1224969 [03:08] Libelula\SinRespeto
R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 14960893 #4: Cocodrilo-ConPrisa 13978660 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3677435 #9: LaCamelia 3029384 #10: Karen 1224969
[03:08] Libelula\SinRespeto Tri.1977 Mitologiaɴamzarian˿Cuᬃ01berauelbnombregdeglasydosycolumnasydegH鲣ules?i?i [03:08] Libelula\SinRespeto
Tri.1977 Mitologiaɴamzarian˿Cuᬃ01berauelbnombregdeglasydosycolumnasydegH鲣ules?i?i
[03:08] Libelula\SinRespeto 1 Pista: ***** * ***** Valor pregunta : 10771 Puntos [03:08] Libelula\SinRespeto
1 Pista: ***** * ***** Valor pregunta : 10771 Puntos
[03:08] Aguila}Insufrible ahorita te hago fraking [03:08] Aguila}Insufrible
ahorita te hago fraking
[03:08] Aguila}Insufrible como negocio petrolero [03:08] Aguila}Insufrible
como negocio petrolero
[03:08] Libelula\SinRespeto 2 Pista: aby** * ***** 30 segundos y 10771 Puntos [03:08] Libelula\SinRespeto
2 Pista: aby** * ***** 30 segundos y 10771 Puntos
[03:08] Aguila}Insufrible jjajajajajajajaja [03:08] Aguila}Insufrible
jjajajajajajajaja
[03:09] Hipopotamo}Breve ahorita dice xD [03:09] Hipopotamo}Breve
ahorita dice xD
[03:09] Libelula\SinRespeto 3 Pista: aby*a * *a**e 15 segundos y 10771 Puntos [03:09] Libelula\SinRespeto
3 Pista: aby*a * *a**e 15 segundos y 10771 Puntos
[03:09] EstrellaDeMar\Pedante [Aguila}Insufrible] No te pongas a negociar con mangueras de juguetes. [03:09] EstrellaDeMar\Pedante
[Aguila}Insufrible] No te pongas a negociar con mangueras de juguetes.
[03:09] EstrellaDeMar\Pedante xD [03:09] EstrellaDeMar\Pedante
xD
[03:09] Libelula\SinRespeto Tiempo! La respuesta es -> abyla��alpe <- [03:09] Libelula\SinRespeto
Tiempo! La respuesta es -> abyla��alpe <-
[03:09] Aguila}Insufrible ahorita va perecer que lleg󠥸xon, mobil, shell y puras de eeaas [03:09] Aguila}Insufrible
ahorita va perecer que lleg󠥸xon, mobil, shell y puras de eeaas
[03:09] Libelula\SinRespeto Please refrain from using Extreme Bad Language [03:09] Libelula\SinRespeto
Please refrain from using Extreme Bad Language
[03:09] Libelula\SinRespeto Tri.2454 GeografiaɞIrati˿ElurionSaarfseqencuentratenrelusuroesteqde...a?a [03:09] Libelula\SinRespeto
Tri.2454 GeografiaɞIrati˿ElurionSaarfseqencuentratenrelusuroesteqde...a?a
[03:09] Libelula\SinRespeto 1 Pista: ******** Valor pregunta : 8117 Puntos [03:09] Libelula\SinRespeto
1 Pista: ******** Valor pregunta : 8117 Puntos
[03:10] Libelula\SinRespeto 2 Pista: ale***** 30 segundos y 8117 Puntos [03:10] Libelula\SinRespeto
2 Pista: ale***** 30 segundos y 8117 Puntos
[03:10] Aguila}Insufrible alemania [03:10] Aguila}Insufrible
alemania
[03:10] Libelula\SinRespeto �Absolutamente correcto Aguila}Insufrible!! Acertaste "alemania" en �2.922 segundos y ganas �117�12 puntos [03:10] Libelula\SinRespeto
�Absolutamente correcto Aguila}Insufrible!! Acertaste "alemania" en �2.922 segundos y ganas �117�12 puntos
[03:10] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [03:10] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[03:10] Libelula\SinRespeto Aguila}Insufrible has acertado 14 seguidas!! Puntos HOY: 871826, SEMANA: 18660825 y MES: 14989262 [03:10] Libelula\SinRespeto
Aguila}Insufrible has acertado 14 seguidas!! Puntos HOY: 871826, SEMANA: 18660825 y MES: 14989262
[03:10] Libelula\SinRespeto This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto [03:10] Libelula\SinRespeto
This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto
[03:10] Libelula\SinRespeto Tri.12987 Cancionesɔarlang˿Debquebgrupozeshlavcancionb"quierozbeberkhastavperderkelhcontrol"w?w [03:10] Libelula\SinRespeto
Tri.12987 Cancionesɔarlang˿Debquebgrupozeshlavcancionb"quierozbeberkhastavperderkelhcontrol"w?w
[03:10] Libelula\SinRespeto 1 Pista: *** ******** Valor pregunta : 5602 Puntos [03:10] Libelula\SinRespeto
1 Pista: *** ******** Valor pregunta : 5602 Puntos
[03:10] Libelula\SinRespeto 2 Pista: los ******** 30 segundos y 5602 Puntos [03:10] Libelula\SinRespeto
2 Pista: los ******** 30 segundos y 5602 Puntos
[03:11] Libelula\SinRespeto 3 Pista: los *e**e*o* 15 segundos y 5602 Puntos [03:11] Libelula\SinRespeto
3 Pista: los *e**e*o* 15 segundos y 5602 Puntos
[03:11] Libelula\SinRespeto Tiempo! La respuesta es -> los�ecretos <- [03:11] Libelula\SinRespeto
Tiempo! La respuesta es -> los�ecretos <-
[03:11] Libelula\SinRespeto This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 560826 #19: karen-62 535210 #20: Carlos_55 468075 [03:11] Libelula\SinRespeto
This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 560826 #19: karen-62 535210 #20: Carlos_55 468075
[03:11] Libelula\SinRespeto Tri.14784 ArteɈdosO˿Acquexestilogarquitect󮩣ogpertenecexeljCapitoliogdexWashingtonp?c [03:11] Libelula\SinRespeto
Tri.14784 ArteɈdosO˿Acquexestilogarquitect󮩣ogpertenecexeljCapitoliogdexWashingtonp?c
[03:11] Libelula\SinRespeto 1 Pista: ********** Valor pregunta : 19402 Puntos [03:11] Libelula\SinRespeto
1 Pista: ********** Valor pregunta : 19402 Puntos
[03:11] Libelula\SinRespeto 2 Pista: neo******* 30 segundos y 19402 Puntos [03:11] Libelula\SinRespeto
2 Pista: neo******* 30 segundos y 19402 Puntos
[03:12] Libelula\SinRespeto 3 Pista: neo**a*i*o 15 segundos y 19402 Puntos [03:12] Libelula\SinRespeto
3 Pista: neo**a*i*o 15 segundos y 19402 Puntos
[03:12] Libelula\SinRespeto Tiempo! La respuesta es -> neoclasico <- [03:12] Libelula\SinRespeto
Tiempo! La respuesta es -> neoclasico <-
[03:12] Aguila}Insufrible neoclasico [03:12] Aguila}Insufrible
neoclasico
[03:12] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [03:12] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[03:12] Libelula\SinRespeto Tri.10204 MiscelaneaɔeLaRaNhA˿Ellqueqcareceqdeqideash?a [03:12] Libelula\SinRespeto
Tri.10204 MiscelaneaɔeLaRaNhA˿Ellqueqcareceqdeqideash?a
[03:12] Libelula\SinRespeto 1 Pista: **** ***** *** ****** Pregunta de BONUS : 200000 Puntos [03:12] Libelula\SinRespeto
1 Pista: **** ***** *** ****** Pregunta de BONUS : 200000 Puntos
[03:12] Libelula\SinRespeto 2 Pista: hac* ***** *** ****** 30 segundos y 200000 Puntos [03:12] Libelula\SinRespeto
2 Pista: hac* ***** *** ****** 30 segundos y 200000 Puntos
[03:13] Libelula\SinRespeto 3 Pista: hace *u*a* *a* a*e*a* 15 segundos y 200000 Puntos [03:13] Libelula\SinRespeto
3 Pista: hace *u*a* *a* a*e*a* 15 segundos y 200000 Puntos
[03:13] Libelula\SinRespeto Tiempo! La respuesta es -> hace�uyas�as�jenas <- [03:13] Libelula\SinRespeto
Tiempo! La respuesta es -> hace�uyas�as�jenas <-
[03:13] EstrellaDeMar\Pedante [Aguila}Insufrible] Se lo cuida, se lo lava y se lo peina. [03:13] EstrellaDeMar\Pedante
[Aguila}Insufrible] Se lo cuida, se lo lava y se lo peina.
[03:13] Libelula\SinRespeto This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 581548 #15: Aguila-Especial 551121 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704 [03:13] Libelula\SinRespeto
This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 581548 #15: Aguila-Especial 551121 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704
[03:13] Libelula\SinRespeto Tri.4359 Cotilleo-TVɣarlovigo˿Comolseellamabaclac4ʃ01sSuperNenacqueesololaparecioleneunecapitulo?s?s [03:13] Libelula\SinRespeto
Tri.4359 Cotilleo-TVɣarlovigo˿Comolseellamabaclac4ʃ01sSuperNenacqueesololaparecioleneunecapitulo?s?s
[03:13] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 15146 Puntos [03:13] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 15146 Puntos
[03:13] Aguila}Insufrible para queee?? [03:13] Aguila}Insufrible
para queee??
[03:13] EstrellaDeMar\Pedante [Hipopotamo}Breve] Muuuaaackkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk, te asmo, cosita. [03:13] EstrellaDeMar\Pedante
[Hipopotamo}Breve] Muuuaaackkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk, te asmo, cosita.
[03:13] Aguila}Insufrible a donde lo vas a invitar? [03:13] Aguila}Insufrible
a donde lo vas a invitar?
[03:13] Aguila}Insufrible ya te vassss? [03:13] Aguila}Insufrible
ya te vassss?
[03:13] Hipopotamo}Breve [EstrellaDeMar\Pedante] te asmo mas muackssssssssssssssssssssssssssssssss [03:13] Hipopotamo}Breve
[EstrellaDeMar\Pedante] te asmo mas muackssssssssssssssssssssssssssssssss
[03:13] EstrellaDeMar\Pedante [Aguila}Insufrible] Para que se lo tire a los perros. [03:13] EstrellaDeMar\Pedante
[Aguila}Insufrible] Para que se lo tire a los perros.
[03:13] Libelula\SinRespeto 2 Pista: bon*** 30 segundos y 15146 Puntos [03:13] Libelula\SinRespeto
2 Pista: bon*** 30 segundos y 15146 Puntos
[03:13] Aguila}Insufrible jajajajajajajajaja [03:13] Aguila}Insufrible
jajajajajajajajaja
[03:13] Aguila}Insufrible bonnie [03:13] Aguila}Insufrible
bonnie
[03:13] Libelula\SinRespeto �Eso es Aguila}Insufrible!! Dijiste: "bonnie" y ello te ha valido: �5146�12 puntos [03:13] Libelula\SinRespeto
�Eso es Aguila}Insufrible!! Dijiste: "bonnie" y ello te ha valido: �5146�12 puntos
[03:13] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [03:13] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[03:13] Libelula\SinRespeto Aguila}Insufrible has acertado 15 seguidas!! Puntos HOY: 886972, SEMANA: 18675971 y MES: 15004408 [03:13] Libelula\SinRespeto
Aguila}Insufrible has acertado 15 seguidas!! Puntos HOY: 886972, SEMANA: 18675971 y MES: 15004408
[03:13] EstrellaDeMar\Pedante S�ya reclaman mi presencia. xD [03:13] EstrellaDeMar\Pedante
S�ya reclaman mi presencia. xD
[03:13] Aguila}Insufrible voy contigo? [03:13] Aguila}Insufrible
voy contigo?
[03:14] Libelula\SinRespeto R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0 [03:14] Libelula\SinRespeto
R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0
[03:14] Libelula\SinRespeto Tri.2465 Gastronomiaɡnghara˿Lahleberwurstveswdeo?y [03:14] Libelula\SinRespeto
Tri.2465 Gastronomiaɡnghara˿Lahleberwurstveswdeo?y
[03:14] Libelula\SinRespeto 1 Pista: ******** Valor pregunta : 9009 Puntos [03:14] Libelula\SinRespeto
1 Pista: ******** Valor pregunta : 9009 Puntos
[03:14] Aguila}Insufrible quiero morder tambien [03:14] Aguila}Insufrible
quiero morder tambien
[03:14] EstrellaDeMar\Pedante [Aguila}Insufrible] No llevo le񡠰ara el monte. xD [03:14] EstrellaDeMar\Pedante
[Aguila}Insufrible] No llevo le񡠰ara el monte. xD
[03:14] Libelula\SinRespeto �Increible!! Aguila}Insufrible contest󺠃04"alemania" en �.531 segundos, y ha ganado �009�12 puntos [03:14] Libelula\SinRespeto
�Increible!! Aguila}Insufrible contest󺠃04"alemania" en �.531 segundos, y ha ganado �009�12 puntos
[03:14] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [03:14] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[03:14] Libelula\SinRespeto Aguila}Insufrible has acertado 16 seguidas!! Puntos HOY: 895981, SEMANA: 18684980 y MES: 15013417 [03:14] Libelula\SinRespeto
Aguila}Insufrible has acertado 16 seguidas!! Puntos HOY: 895981, SEMANA: 18684980 y MES: 15013417
[03:14] Aguila}Insufrible alemania [03:14] Aguila}Insufrible
alemania
[03:14] EstrellaDeMar\Pedante Si quisiera una mascota, me la comprara. [03:14] EstrellaDeMar\Pedante
Si quisiera una mascota, me la comprara.
[03:14] Libelula\SinRespeto Top10 Players ( Weekly & Monthly ) are Auto-Voiced [03:14] Libelula\SinRespeto
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[03:14] Libelula\SinRespeto Tri.20135 Fisica-QuimicaɐiNKiTa˿CUALpESpELpULTIMOpELEMENTOpNATURALpDEpLApTABLApPERIODICAp?p [03:14] Libelula\SinRespeto
Tri.20135 Fisica-QuimicaɐiNKiTa˿CUALpESpELpULTIMOpELEMENTOpNATURALpDEpLApTABLApPERIODICAp?p
[03:14] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 19661 Puntos [03:14] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 19661 Puntos
[03:14] Aguila}Insufrible jajajajajajajaj [03:14] Aguila}Insufrible
jajajajajajajaj
[03:14] Hipopotamo}Breve xD [03:14] Hipopotamo}Breve
xD
[03:14] EstrellaDeMar\Pedante Chao con adi�s. [03:14] EstrellaDeMar\Pedante
Chao con adi�s.
[03:14] Hipopotamo}Breve yo me ire con EstrellaDeMar\Pedante [03:14] Hipopotamo}Breve
yo me ire con EstrellaDeMar\Pedante
[03:14] Libelula\SinRespeto 2 Pista: ura*** 30 segundos y 19661 Puntos [03:14] Libelula\SinRespeto
2 Pista: ura*** 30 segundos y 19661 Puntos
[03:14] Cocodrilo-ConPrisa fancio [03:14] Cocodrilo-ConPrisa
fancio
[03:14] Aguila}Insufrible uranio [03:14] Aguila}Insufrible
uranio
[03:14] Libelula\SinRespeto �Muy bien Aguila}Insufrible!! Acertaste "uranio" en tan s󬯠�9.609 segundos y por eso has ganado: �9661�12 puntos [03:14] Libelula\SinRespeto
�Muy bien Aguila}Insufrible!! Acertaste "uranio" en tan s󬯠�9.609 segundos y por eso has ganado: �9661�12 puntos
[03:14] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [03:14] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[03:14] Libelula\SinRespeto Aguila}Insufrible has acertado 17 seguidas!! Puntos HOY: 915642, SEMANA: 18704641 y MES: 15033078 [03:14] Libelula\SinRespeto
Aguila}Insufrible has acertado 17 seguidas!! Puntos HOY: 915642, SEMANA: 18704641 y MES: 15033078
[03:14] Cocodrilo-ConPrisa uranio [03:14] Cocodrilo-ConPrisa
uranio
[03:15] Libelula\SinRespeto Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [03:15] Libelula\SinRespeto
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[03:15] Libelula\SinRespeto Tri.19037 Mitologiaɴjmm.comˌaswtreswGracias:iEufr󳩮e,i�laeqy....i?i [03:15] Libelula\SinRespeto
Tri.19037 Mitologiaɴjmm.comˌaswtreswGracias:iEufr󳩮e,i�laeqy....i?i
[03:15] Libelula\SinRespeto 1 Pista: ***** Valor pregunta : 24005 Puntos [03:15] Libelula\SinRespeto
1 Pista: ***** Valor pregunta : 24005 Puntos
[03:15] Libelula\SinRespeto 2 Pista: tal** 30 segundos y 24005 Puntos [03:15] Libelula\SinRespeto
2 Pista: tal** 30 segundos y 24005 Puntos
[03:15] Cocodrilo-ConPrisa talia [03:15] Cocodrilo-ConPrisa
talia
[03:15] Libelula\SinRespeto �Suma y sigue Cocodrilo-ConPrisa!! La respuesta: "talia" incrementa tu marcador en �4005�12 puntos [03:15] Libelula\SinRespeto
�Suma y sigue Cocodrilo-ConPrisa!! La respuesta: "talia" incrementa tu marcador en �4005�12 puntos
[03:15] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 1 seguidas!! Puntos HOY: 503688, SEMANA: 14002665 y MES: 14002665 [03:15] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 1 seguidas!! Puntos HOY: 503688, SEMANA: 14002665 y MES: 14002665
[03:15] Libelula\SinRespeto R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 18704641 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 14002665 #5: Culebra}Agil 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3677435 [03:15] Libelula\SinRespeto
R᮫ing SEMANA: - #1: {FoSFoRiTa} 18775389 #2: Aguila}Insufrible 18704641 #3: Patito_Feo 17127023 #4: Cocodrilo-ConPrisa 14002665 #5: Culebra}Agil 10741018 #6: ELE-AZAR 6763214 #7: Bowser 6286106 #8: Aliiiiiiii 5572428 #9: SMAW 4012154 #10: Hipopotamo\Eficiente 3677435
[03:15] Libelula\SinRespeto Tri.20142 MitologiaɺAnn˿AbuelosmdegZeusm?e [03:15] Libelula\SinRespeto
Tri.20142 MitologiaɺAnn˿AbuelosmdegZeusm?e
[03:15] Libelula\SinRespeto 1 Pista: ***** * *** Valor pregunta : 16005 Puntos [03:15] Libelula\SinRespeto
1 Pista: ***** * *** Valor pregunta : 16005 Puntos
[03:15] Libelula\SinRespeto 2 Pista: ura** * *** 30 segundos y 16005 Puntos [03:15] Libelula\SinRespeto
2 Pista: ura** * *** 30 segundos y 16005 Puntos
[03:15] Cocodrilo-ConPrisa urano y gea [03:15] Cocodrilo-ConPrisa
urano y gea
[03:15] Libelula\SinRespeto �Absolutamente correcto Cocodrilo-ConPrisa!! Acertaste "urano y gea" en �5.922 segundos y ganas �6005�12 puntos [03:15] Libelula\SinRespeto
�Absolutamente correcto Cocodrilo-ConPrisa!! Acertaste "urano y gea" en �5.922 segundos y ganas �6005�12 puntos
[03:15] Libelula\SinRespeto Cocodrilo-ConPrisa has acertado 2 seguidas!! Puntos HOY: 519693, SEMANA: 14018670 y MES: 14018670 [03:15] Libelula\SinRespeto
Cocodrilo-ConPrisa has acertado 2 seguidas!! Puntos HOY: 519693, SEMANA: 14018670 y MES: 14018670
[03:16] Libelula\SinRespeto We feature over 50,000 Q&A ! [03:16] Libelula\SinRespeto
We feature over 50,000 Q&A !
[03:16] Libelula\SinRespeto Tri.15290 Medicina-SaludɅlNene˿Cuantossgramossdevplatatllevatunlmetroscuadradosdevpeliculatradiografica?i?i [03:16] Libelula\SinRespeto
Tri.15290 Medicina-SaludɅlNene˿Cuantossgramossdevplatatllevatunlmetroscuadradosdevpeliculatradiografica?i?i
[03:16] Libelula\SinRespeto 1 Pista: **** ****** Valor pregunta : 21702 Puntos [03:16] Libelula\SinRespeto
1 Pista: **** ****** Valor pregunta : 21702 Puntos
[03:16] Aguila}Insufrible diez gramos [03:16] Aguila}Insufrible
diez gramos
[03:16] Libelula\SinRespeto 2 Pista: och* ****** 30 segundos y 21702 Puntos [03:16] Libelula\SinRespeto
2 Pista: och* ****** 30 segundos y 21702 Puntos
[03:16] Aguila}Insufrible seis gramos [03:16] Aguila}Insufrible
seis gramos
[03:16] Libelula\SinRespeto �Muy bien Aguila}Insufrible!! Acertaste "ocho gramos" en tan s󬯠�7.641 segundos y por eso has ganado: �1702�12 puntos [03:16] Libelula\SinRespeto
�Muy bien Aguila}Insufrible!! Acertaste "ocho gramos" en tan s󬯠�7.641 segundos y por eso has ganado: �1702�12 puntos
[03:16] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [03:16] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[03:16] Libelula\SinRespeto Aguila}Insufrible has acertado 1 seguidas!! Puntos HOY: 937344, SEMANA: 18726343 y MES: 15054780 [03:16] Libelula\SinRespeto
Aguila}Insufrible has acertado 1 seguidas!! Puntos HOY: 937344, SEMANA: 18726343 y MES: 15054780
[03:16] Aguila}Insufrible ocho gramos [03:16] Aguila}Insufrible
ocho gramos
[03:16] Cocodrilo-ConPrisa ocho gramos [03:16] Cocodrilo-ConPrisa
ocho gramos
[03:16] Libelula\SinRespeto Tri.14474 MitologiaɆrigotora˿HijotdeyNicteyyndeyHipno,qdiosddeylosdsue񯳿q?q [03:16] Libelula\SinRespeto
Tri.14474 MitologiaɆrigotora˿HijotdeyNicteyyndeyHipno,qdiosddeylosdsue񯳿q?q
[03:16] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 19501 Puntos [03:16] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 19501 Puntos
[03:16] Libelula\SinRespeto �Eso es Aguila}Insufrible!! Dijiste: "morfeo" y ello te ha valido: �9501�12 puntos [03:16] Libelula\SinRespeto
�Eso es Aguila}Insufrible!! Dijiste: "morfeo" y ello te ha valido: �9501�12 puntos
[03:16] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [03:16] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[03:16] Libelula\SinRespeto Aguila}Insufrible has acertado 2 seguidas!! Puntos HOY: 956845, SEMANA: 18745844 y MES: 15074281 [03:16] Libelula\SinRespeto
Aguila}Insufrible has acertado 2 seguidas!! Puntos HOY: 956845, SEMANA: 18745844 y MES: 15074281
[03:16] Aguila}Insufrible morfeo [03:16] Aguila}Insufrible
morfeo
[03:17] Libelula\SinRespeto Tri.5343 MitologiaɍARdeJAVA˿AfQUɃ01fMITOLOǴfPERTENECENfLOSfDIOSESfBELENUS,fCERNUNOSfYfOGMA?f?f [03:17] Libelula\SinRespeto
Tri.5343 MitologiaɍARdeJAVA˿AfQUɃ01fMITOLOǴfPERTENECENfLOSfDIOSESfBELENUS,fCERNUNOSfYfOGMA?f?f
[03:17] Libelula\SinRespeto 1 Pista: ***** Valor pregunta : 8554 Puntos [03:17] Libelula\SinRespeto
1 Pista: ***** Valor pregunta : 8554 Puntos
[03:17] Aguila}Insufrible celta [03:17] Aguila}Insufrible
celta
[03:17] Libelula\SinRespeto �As�e hace Aguila}Insufrible!! Contestaste "celta" en �.219 segundos y sumas �554�12 puntos [03:17] Libelula\SinRespeto
�As�e hace Aguila}Insufrible!! Contestaste "celta" en �.219 segundos y sumas �554�12 puntos
[03:17] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [03:17] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[03:17] Libelula\SinRespeto Aguila}Insufrible has acertado 3 seguidas!! Puntos HOY: 965399, SEMANA: 18754398 y MES: 15082835 [03:17] Libelula\SinRespeto
Aguila}Insufrible has acertado 3 seguidas!! Puntos HOY: 965399, SEMANA: 18754398 y MES: 15082835
[03:17] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [03:17] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[03:17] Libelula\SinRespeto Tri.7000 CienciaɆilipides˿1966.eLadfirmadBarreirostpresentadenpelqSIMOeunpveh�loidotadoidekradiotel馯no,edict᦯no,emᱵinaddekescribirjelect󮩣adytarchivo.eߓulnombrek?e [03:17] Libelula\SinRespeto
Tri.7000 CienciaɆilipides˿1966.eLadfirmadBarreirostpresentadenpelqSIMOeunpveh�loidotadoidekradiotel馯no,edict᦯no,emᱵinaddekescribirjelect󮩣adytarchivo.eߓulnombrek?e
[03:17] Libelula\SinRespeto 1 Pista: ******** ******* Valor pregunta : 21546 Puntos [03:17] Libelula\SinRespeto
1 Pista: ******** ******* Valor pregunta : 21546 Puntos
[03:17] Libelula\SinRespeto 2 Pista: des***** ******* 30 segundos y 21546 Puntos [03:17] Libelula\SinRespeto
2 Pista: des***** ******* 30 segundos y 21546 Puntos
[03:18] Libelula\SinRespeto 3 Pista: des*a**o *o*a**e 15 segundos y 21546 Puntos [03:18] Libelula\SinRespeto
3 Pista: des*a**o *o*a**e 15 segundos y 21546 Puntos
[03:18] Libelula\SinRespeto Tiempo! La respuesta es -> despacho�odante <- [03:18] Libelula\SinRespeto
Tiempo! La respuesta es -> despacho�odante <-
[03:18] Libelula\SinRespeto R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0 [03:18] Libelula\SinRespeto
R᮫ing �ltimo MES: #1: * 0 #2: * 0 #3: * 0 #4: * 0 #5: * 0
[03:18] Libelula\SinRespeto Tri.5582 Politicaɳica˿Enpqu郰1mpa�01frein󃰱mlarEmperatrizmCixiu?m [03:18] Libelula\SinRespeto
Tri.5582 Politicaɳica˿Enpqu郰1mpa�01frein󃰱mlarEmperatrizmCixiu?m
[03:18] Libelula\SinRespeto 1 Pista: ***** Pregunta de BONUS : 25000 Puntos [03:18] Libelula\SinRespeto
1 Pista: ***** Pregunta de BONUS : 25000 Puntos
[03:18] Libelula\SinRespeto 2 Pista: chi** 30 segundos y 25000 Puntos [03:18] Libelula\SinRespeto
2 Pista: chi** 30 segundos y 25000 Puntos
[03:18] Aguila}Insufrible china [03:18] Aguila}Insufrible
china
[03:18] Libelula\SinRespeto �Increible!! Aguila}Insufrible contest󺠃04"china" en �6.766 segundos, y ha ganado �5000�12 puntos [03:18] Libelula\SinRespeto
�Increible!! Aguila}Insufrible contest󺠃04"china" en �6.766 segundos, y ha ganado �5000�12 puntos
[03:18] Libelula\SinRespeto ACTION awards Aguila}Insufrible with a +v for having over 15000 points [03:18] Libelula\SinRespeto
ACTION awards Aguila}Insufrible with a +v for having over 15000 points
[03:18] Libelula\SinRespeto Aguila}Insufrible has acertado 4 seguidas!! Puntos HOY: 990399, SEMANA: 18779398 y MES: 15107835 [03:18] Libelula\SinRespeto
Aguila}Insufrible has acertado 4 seguidas!! Puntos HOY: 990399, SEMANA: 18779398 y MES: 15107835
[03:19] Libelula\SinRespeto If you think a Q&A is wrong, please call an OP [03:19] Libelula\SinRespeto
If you think a Q&A is wrong, please call an OP
[03:19] Libelula\SinRespeto Tri.18957 Idiomasɍachakao˿ENwLATINwLEVANTARSEw?w [03:19] Libelula\SinRespeto
Tri.18957 Idiomasɍachakao˿ENwLATINwLEVANTARSEw?w
[03:19] Libelula\SinRespeto 1 Pista: ******* Valor pregunta : 19200 Puntos [03:19] Libelula\SinRespeto
1 Pista: ******* Valor pregunta : 19200 Puntos
[03:19] Libelula\SinRespeto 2 Pista: sur**** 30 segundos y 19200 Puntos [03:19] Libelula\SinRespeto
2 Pista: sur**** 30 segundos y 19200 Puntos
[03:19] Libelula\SinRespeto 3 Pista: sur*e*e 15 segundos y 19200 Puntos [03:19] Libelula\SinRespeto
3 Pista: sur*e*e 15 segundos y 19200 Puntos
[03:20] Libelula\SinRespeto Tiempo! La respuesta es -> surgere <- [03:20] Libelula\SinRespeto
Tiempo! La respuesta es -> surgere <-
[03:20] Libelula\SinRespeto R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0 [03:20] Libelula\SinRespeto
R᮫ing por D́: - Domingo: Cocodrilo-ConPrisa 8389382 Lunes: Aguila}Insufrible 439202 Martes: Aguila}Insufrible 3723143 Miercoles: Aguila}Insufrible 2928711 Jueves: {FoSFoRiTa} 511120 Viernes: Aguila}Insufrible 3683447 Sᢡdo: * 0
[03:20] Libelula\SinRespeto Tri.9159 EconomiaɌuci^ˍonedandeeloslPa�slBajoslanteriorlalheuro.n?n [03:20] Libelula\SinRespeto
Tri.9159 EconomiaɌuci^ˍonedandeeloslPa�slBajoslanteriorlalheuro.n?n
[03:20] Libelula\SinRespeto 1 Pista: ****** Valor pregunta : 5928 Puntos [03:20] Libelula\SinRespeto
1 Pista: ****** Valor pregunta : 5928 Puntos
[03:20] Libelula\SinRespeto 2 Pista: flo*** 30 segundos y 5928 Puntos [03:20] Libelula\SinRespeto
2 Pista: flo*** 30 segundos y 5928 Puntos
[03:20] Libelula\SinRespeto 3 Pista: flo*i* 15 segundos y 5928 Puntos [03:20] Libelula\SinRespeto
3 Pista: flo*i* 15 segundos y 5928 Puntos
[03:21] Libelula\SinRespeto Tiempo! La respuesta es -> florin <- [03:21] Libelula\SinRespeto
Tiempo! La respuesta es -> florin <-
[03:21] Libelula\SinRespeto For The Competitive Edge type !pingme [03:21] Libelula\SinRespeto
For The Competitive Edge type !pingme
[03:21] Libelula\SinRespeto Tri.13618 Historiaɳherif˨IIwGuerraiMundial)wߑui鮃01sfueieluencargadosdeigobernarwlai"FranciaideiVichy",wsurgidaitrasjlaiinvasi󮃰1sdeluIIIwReich?w?w [03:21] Libelula\SinRespeto
Tri.13618 Historiaɳherif˨IIwGuerraiMundial)wߑui鮃01sfueieluencargadosdeigobernarwlai"FranciaideiVichy",wsurgidaitrasjlaiinvasi󮃰1sdeluIIIwReich?w?w
[03:21] Libelula\SinRespeto 1 Pista: ******** ****** Valor pregunta : 24551 Puntos [03:21] Libelula\SinRespeto
1 Pista: ******** ****** Valor pregunta : 24551 Puntos
[03:21] Libelula\SinRespeto 2 Pista: mar***** ****** 30 segundos y 24551 Puntos [03:21] Libelula\SinRespeto
2 Pista: mar***** ****** 30 segundos y 24551 Puntos
[03:21] Libelula\SinRespeto 3 Pista: mari**a* *e*ai* 15 segundos y 24551 Puntos [03:21] Libelula\SinRespeto
3 Pista: mari**a* *e*ai* 15 segundos y 24551 Puntos
[03:22] Libelula\SinRespeto Tiempo! La respuesta es -> mariscal�etain <- [03:22] Libelula\SinRespeto
Tiempo! La respuesta es -> mariscal�etain <-
[03:22] Libelula\SinRespeto Watch for the 25.000Point & 50.000 Point BONUS Questions !!! [03:22] Libelula\SinRespeto
Watch for the 25.000Point & 50.000 Point BONUS Questions !!!
[03:22] Libelula\SinRespeto Tri.9871 Politicaɭ˿Auqui鮃01zcorrespondealanelaboraci󮃰1zdealosfPresupuestosfGeneralesfdelyEstadoy?u [03:22] Libelula\SinRespeto
Tri.9871 Politicaɭ˿Auqui鮃01zcorrespondealanelaboraci󮃰1zdealosfPresupuestosfGeneralesfdelyEstadoy?u
[03:22] Libelula\SinRespeto 1 Pista: ******** Valor pregunta : 24025 Puntos [03:22] Libelula\SinRespeto
1 Pista: ******** Valor pregunta : 24025 Puntos
[03:22] Libelula\SinRespeto 2 Pista: gob***** 30 segundos y 24025 Puntos [03:22] Libelula\SinRespeto
2 Pista: gob***** 30 segundos y 24025 Puntos
[03:22] Libelula\SinRespeto 3 Pista: gobie**o 15 segundos y 24025 Puntos [03:22] Libelula\SinRespeto
3 Pista: gobie**o 15 segundos y 24025 Puntos
[03:23] Libelula\SinRespeto Tiempo! La respuesta es -> gobierno <- [03:23] Libelula\SinRespeto
Tiempo! La respuesta es -> gobierno <-
[03:23] Libelula\SinRespeto R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 15107835 #4: Cocodrilo-ConPrisa 14018670 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3677435 #9: LaCamelia 3029384 #10: Karen 1224969 [03:23] Libelula\SinRespeto
R᮫ing MES: - #1: Patito_Feo 16651319 #2: {FoSFoRiTa} 16542673 #3: Aguila}Insufrible 15107835 #4: Cocodrilo-ConPrisa 14018670 #5: Bowser 6286106 #6: Aliiiiiiii 5572428 #7: SMAW 4012154 #8: Hipopotamo\Eficiente 3677435 #9: LaCamelia 3029384 #10: Karen 1224969
[03:23] Libelula\SinRespeto Tri.6089 Miscelaneaɓebosin˿(Derecho)xLawreconciliaci󮃰1hentrezlosgc󮹵gesgseparadosgdejawsinhefectoqlawsentenciawdezseparaci󮬃01xsinhm᳃01grequisitoqquez...?x?x [03:23] Libelula\SinRespeto
Tri.6089 Miscelaneaɓebosin˿(Derecho)xLawreconciliaci󮃰1hentrezlosgc󮹵gesgseparadosgdejawsinhefectoqlawsentenciawdezseparaci󮬃01xsinhm᳃01grequisitoqquez...?x?x
[03:23] Libelula\SinRespeto 1 Pista: *********** ** ******* Valor pregunta : 12636 Puntos [03:23] Libelula\SinRespeto
1 Pista: *********** ** ******* Valor pregunta : 12636 Puntos
[03:23] Libelula\SinRespeto 2 Pista: com******** ** ******* 30 segundos y 12636 Puntos [03:23] Libelula\SinRespeto
2 Pista: com******** ** ******* 30 segundos y 12636 Puntos
[03:23] Libelula\SinRespeto 3 Pista: comu*i*a**o a* *u**a*o 15 segundos y 12636 Puntos [03:23] Libelula\SinRespeto
3 Pista: comu*i*a**o a* *u**a*o 15 segundos y 12636 Puntos
[03:24] Libelula\SinRespeto Tiempo! La respuesta es -> comunicarlo�l�uzgado <- [03:24] Libelula\SinRespeto
Tiempo! La respuesta es -> comunicarlo�l�uzgado <-
[03:24] Libelula\SinRespeto Please refrain from using Extreme Bad Language [03:24] Libelula\SinRespeto
Please refrain from using Extreme Bad Language
[03:24] Libelula\SinRespeto Tri.8587 Medicina-SaludɍARdeJAVA˿AbQUɃ01bTEMENbLASbPERSONASbQUEbSUFRENbDEbCATOPTROFOBIA?b?b [03:24] Libelula\SinRespeto
Tri.8587 Medicina-SaludɍARdeJAVA˿AbQUɃ01bTEMENbLASbPERSONASbQUEbSUFRENbDEbCATOPTROFOBIA?b?b
[03:24] Libelula\SinRespeto 1 Pista: ******* Valor pregunta : 8105 Puntos [03:24] Libelula\SinRespeto
1 Pista: ******* Valor pregunta : 8105 Puntos
[03:24] Libelula\SinRespeto 2 Pista: esp**** 30 segundos y 8105 Puntos [03:24] Libelula\SinRespeto
2 Pista: esp**** 30 segundos y 8105 Puntos
[03:24] Libelula\SinRespeto 3 Pista: espe*o* 15 segundos y 8105 Puntos [03:24] Libelula\SinRespeto
3 Pista: espe*o* 15 segundos y 8105 Puntos
[03:24] Aguila-Especial Espejos [03:24] Aguila-Especial
Espejos
[03:24] Libelula\SinRespeto �Est᳠que lo tiras Aguila-Especial!! ߃󭯠supiste que "Espejos" era la respuesta? Venga, �105�12 puntos suben a tu marcador [03:24] Libelula\SinRespeto
�Est᳠que lo tiras Aguila-Especial!! ߃󭯠supiste que "Espejos" era la respuesta? Venga, �105�12 puntos suben a tu marcador
[03:24] Libelula\SinRespeto Aguila-Especial has acertado 1 seguidas!! Puntos HOY: 16191, SEMANA: 568931 y MES: 559226 [03:24] Libelula\SinRespeto
Aguila-Especial has acertado 1 seguidas!! Puntos HOY: 16191, SEMANA: 568931 y MES: 559226
[03:25] Libelula\SinRespeto This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto [03:25] Libelula\SinRespeto
This is #Mexico, I am your host Libelula\SinRespeto, running Libelula\SinRespeto
[03:25] Libelula\SinRespeto Tri.17823 Historiaɳtephewo˿ComomsegllamabeljcampomdegconcentracionbquegestabenbPostdam?l?l [03:25] Libelula\SinRespeto
Tri.17823 Historiaɳtephewo˿ComomsegllamabeljcampomdegconcentracionbquegestabenbPostdam?l?l
[03:25] Libelula\SinRespeto 1 Pista: ************* Valor pregunta : 23447 Puntos [03:25] Libelula\SinRespeto
1 Pista: ************* Valor pregunta : 23447 Puntos
[03:25] Libelula\SinRespeto 2 Pista: sac********** 30 segundos y 23447 Puntos [03:25] Libelula\SinRespeto
2 Pista: sac********** 30 segundos y 23447 Puntos
[03:25] Libelula\SinRespeto 3 Pista: sac**e**au*e* 15 segundos y 23447 Puntos [03:25] Libelula\SinRespeto
3 Pista: sac**e**au*e* 15 segundos y 23447 Puntos
[03:25] LeonConPereza Bienvenido/a! Topo_Fuerte [Fan] de .::RadioLuna::. [03:25] LeonConPereza
Bienvenido/a! Topo_Fuerte [Fan] de .::RadioLuna::.
[03:25] Libelula\SinRespeto Tiempo! La respuesta es -> sachsenhausen <- [03:25] Libelula\SinRespeto
Tiempo! La respuesta es -> sachsenhausen <-
[03:26] LeonConPereza Emitiendo ( Caracol_ConPereza ) | Lugar ( PuertoRico ) | Temática ( Música Variada ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Pide tu canción comando: !tocame Tema-Artista [03:26] LeonConPereza
Emitiendo ( Caracol_ConPereza ) | Lugar ( PuertoRico ) | Temática ( Música Variada ) | Escúchanos por: www.radiolunademiel.com - La radio que endulza tus sentidos | Pide tu canción comando: !tocame Tema-Artista
[03:26] Libelula\SinRespeto This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 560826 #19: karen-62 535210 #20: Carlos_55 468075 [03:26] Libelula\SinRespeto
This WEEKS Top 11-20: - #11: LaCamelia 3029384 #12: Karen 1224969 #13: LeCaTwaLk_z 1185079 #14: Sirena__ 1003275 #15: Chornobyl 873565 #16: etewsgy 695960 #17: julia__ 611502 #18: Aguila-Especial 560826 #19: karen-62 535210 #20: Carlos_55 468075
[03:26] Libelula\SinRespeto Tri.5162 Economiaɤassler˿C󭯃01oseyllamayelqConjuntoodeyvalores,jt�loshylefectoshdeycursoolegalqqueyfigurankenkelqactivoodeyunayempresa?j?j [03:26] Libelula\SinRespeto
Tri.5162 Economiaɤassler˿C󭯃01oseyllamayelqConjuntoodeyvalores,jt�loshylefectoshdeycursoolegalqqueyfigurankenkelqactivoodeyunayempresa?j?j
[03:26] Libelula\SinRespeto 1 Pista: ******* Valor pregunta : 21027 Puntos [03:26] Libelula\SinRespeto
1 Pista: ******* Valor pregunta : 21027 Puntos
[03:26] Libelula\SinRespeto 2 Pista: car**** 30 segundos y 21027 Puntos [03:26] Libelula\SinRespeto
2 Pista: car**** 30 segundos y 21027 Puntos
[03:26] Libelula\SinRespeto 3 Pista: car*e*a 15 segundos y 21027 Puntos [03:26] Libelula\SinRespeto
3 Pista: car*e*a 15 segundos y 21027 Puntos
[03:26] Aguila-Especial CARRERA [03:26] Aguila-Especial
CARRERA
[03:27] Libelula\SinRespeto Tiempo! La respuesta es -> cartera <- [03:27] Libelula\SinRespeto
Tiempo! La respuesta es -> cartera <-
[03:27] Aguila-Especial Catera [03:27] Aguila-Especial
Catera
[03:27] Aguila-Especial Joo [03:27] Aguila-Especial
Joo
[03:27] Aguila-Especial Topo_Fuerte buena noche senorito [03:27] Aguila-Especial
Topo_Fuerte buena noche senorito
[03:27] Libelula\SinRespeto Please remember this is a FREE service, Please do not complain [03:27] Libelula\SinRespeto
Please remember this is a FREE service, Please do not complain
[03:27] Libelula\SinRespeto Tri.15354 Idiomasɨowlita˿Gallegoy-yespa񯬺olloy?y [03:27] Libelula\SinRespeto
Tri.15354 Idiomasɨowlita˿Gallegoy-yespa񯬺olloy?y
[03:27] Libelula\SinRespeto 1 Pista: *** Pregunta de BONUS : 25000 Puntos [03:27] Libelula\SinRespeto
1 Pista: *** Pregunta de BONUS : 25000 Puntos
[03:27] Topo_Fuerte buenas noches, Aguila-Especial [03:27] Topo_Fuerte
buenas noches, Aguila-Especial
[03:27] Libelula\SinRespeto 2 Pista: ojo 30 segundos y 25000 Puntos [03:27] Libelula\SinRespeto
2 Pista: ojo 30 segundos y 25000 Puntos
[03:27] Aguila-Especial Ojo [03:27] Aguila-Especial
Ojo
[03:27] Libelula\SinRespeto �Ol頃04Aguila-Especial!! Has contestado: "Ojo" en �8.437 segundos y sumas �5000�12 puntos a tu marcador. �Sigue as� [03:27] Libelula\SinRespeto
�Ol頃04Aguila-Especial!! Has contestado: "Ojo" en �8.437 segundos y sumas �5000�12 puntos a tu marcador. �Sigue as�
[03:27] Libelula\SinRespeto Aguila-Especial has acertado 2 seguidas!! Puntos HOY: 41191, SEMANA: 593931 y MES: 584226 [03:27] Libelula\SinRespeto
Aguila-Especial has acertado 2 seguidas!! Puntos HOY: 41191, SEMANA: 593931 y MES: 584226
[03:28] Libelula\SinRespeto This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 581548 #15: Aguila-Especial 559226 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704 [03:28] Libelula\SinRespeto
This MONTHS Top 11-20: - #11: Chornobyl 873565 #12: Sirena__ 734169 #13: julia__ 611502 #14: Culebra}Agil 581548 #15: Aguila-Especial 559226 #16: karen-62 535210 #17: KaZuMa_KiRyU 435575 #18: karen-53 342268 #19: AlbertoA 331475 #20: karen- 298704
[03:28] Libelula\SinRespeto Tri.5554 Personajesɑuim˿Enpqu郰1tpa�01bnaci󃰱telonarradorayzperiodista,tpremiouCervantesbenp1999,tJorgebEdwardsb?t [03:28] Libelula\SinRespeto
Tri.5554 Personajesɑuim˿Enpqu郰1tpa�01bnaci󃰱telonarradorayzperiodista,tpremiouCervantesbenp1999,tJorgebEdwardsb?t
[03:28] Libelula\SinRespeto 1 Pista: ***** Valor pregunta : 24117 Puntos [03:28] Libelula\SinRespeto
1 Pista: ***** Valor pregunta : 24117 Puntos
[03:28] Aguila-Especial Topo_Fuerte lloremos ajajaj emite Caracol_ConPereza pidamos temas de llorar amigo xD [03:28] Aguila-Especial
Topo_Fuerte lloremos ajajaj emite Caracol_ConPereza pidamos temas de llorar amigo xD
[03:28] Libelula\SinRespeto 2 Pista: chi** 30 segundos y 24117 Puntos [03:28] Libelula\SinRespeto
2 Pista: chi** 30 segundos y 24117 Puntos
[03:28] Libelula\SinRespeto 3 Pista: chi*e 15 segundos y 24117 Puntos [03:28] Libelula\SinRespeto
3 Pista: chi*e 15 segundos y 24117 Puntos
[03:28] Libelula\SinRespeto Tiempo! La respuesta es -> chile <- [03:28] Libelula\SinRespeto
Tiempo! La respuesta es -> chile <-
[03:28] Topo_Fuerte ya puse radio , ahora pediremos esos temas, Aguila-Especial [03:28] Topo_Fuerte
ya puse radio , ahora pediremos esos temas, Aguila-Especial
[03:29] Libelula\SinRespeto R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0 [03:29] Libelula\SinRespeto
R᮫ing �ltima SEMANA: #1: * 0 #2: * 0 #3: * 0
[03:29] Libelula\SinRespeto Tri.16513 MiscelaneaɔeLaRaNhA˿Dewsaltamontespacchicharrac?l [03:29] Libelula\SinRespeto
Tri.16513 MiscelaneaɔeLaRaNhA˿Dewsaltamontespacchicharrac?l
[03:29] Libelula\SinRespeto 1 Pista: **** ***** Pregunta de BONUS : 100000 Puntos [03:29] Libelula\SinRespeto
1 Pista: **** ***** Pregunta de BONUS : 100000 Puntos
[03:29] Libelula\SinRespeto 2 Pista: poc* ***** 30 segundos y 100000 Puntos [03:29] Libelula\SinRespeto
2 Pista: poc* ***** 30 segundos y 100000 Puntos
[03:29] Libelula\SinRespeto 3 Pista: poco *a**a 15 segundos y 100000 Puntos [03:29] Libelula\SinRespeto
3 Pista: poco *a**a 15 segundos y 100000 Puntos
[03:29] Libelula\SinRespeto Tiempo! La respuesta es -> poco�arra <- [03:29] Libelula\SinRespeto
Tiempo! La respuesta es -> poco�arra <-
[03:30] Libelula\SinRespeto Top10 Players ( Weekly & Monthly ) are Auto-Voiced [03:30] Libelula\SinRespeto
Top10 Players ( Weekly & Monthly ) are Auto-Voiced
[03:30] Libelula\SinRespeto Tri.3361 Miscelaneaɓebosin˿C󭯃01isedllamaselqjud�01idedRusiasysdedlasEuropascentral?c?c [03:30] Libelula\SinRespeto
Tri.3361 Miscelaneaɓebosin˿C󭯃01isedllamaselqjud�01idedRusiasysdedlasEuropascentral?c?c
[03:30] Libelula\SinRespeto 1 Pista: ******** Valor pregunta : 12911 Puntos [03:30] Libelula\SinRespeto
1 Pista: ******** Valor pregunta : 12911 Puntos
[03:30] Libelula\SinRespeto 2 Pista: ask***** 30 segundos y 12911 Puntos [03:30] Libelula\SinRespeto
2 Pista: ask***** 30 segundos y 12911 Puntos
[03:31] Libelula\SinRespeto 3 Pista: aske*a*i 15 segundos y 12911 Puntos [03:31] Libelula\SinRespeto
3 Pista: aske*a*i 15 segundos y 12911 Puntos
[03:31] Libelula\SinRespeto Tiempo! La respuesta es -> askenazi <- [03:31] Libelula\SinRespeto
Tiempo! La respuesta es -> askenazi <-
[03:31] Libelula\SinRespeto Please report incorrect Q&A WITH Question Number & Correction to a Channel OP [03:31] Libelula\SinRespeto
Please report incorrect Q&A WITH Question Number & Correction to a Channel OP
[03:31] Libelula\SinRespeto Tri.19003 Miscelaneaɓebosin˿(Religi󮩅ntqu郰1ymontehsehprodujoolaxTransfiguraci󮃰1tdehJes�s?y?y [03:31] Libelula\SinRespeto
Tri.19003 Miscelaneaɓebosin˿(Religi󮩅ntqu郰1ymontehsehprodujoolaxTransfiguraci󮃰1tdehJes�s?y?y
[03:31] Libelula\SinRespeto 1 Pista: ***** Valor pregunta : 10242 Puntos [03:31] Libelula\SinRespeto
1 Pista: ***** Valor pregunta : 10242 Puntos
[03:31] Libelula\SinRespeto Trivial parado por Jugador! [03:31] Libelula\SinRespeto
Trivial parado por Jugador!
| Compartir en: